DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4709 and AT2G42330

DIOPT Version :9

Sequence 1:NP_001285788.1 Gene:CG4709 / 34324 FlyBaseID:FBgn0032169 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_001078041.1 Gene:AT2G42330 / 818834 AraportID:AT2G42330 Length:752 Species:Arabidopsis thaliana


Alignment Length:318 Identity:66/318 - (20%)
Similarity:117/318 - (36%) Gaps:76/318 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 KERERDFKFEELYPLT--TDQDEDDELSSEESNSSMNDNSSDEAESDMDD-LEEARRARMVELSL 296
            ||:.|..|.:.:|...  :|.:.||...|..............:..::|. |::.|....::.:.
plant     7 KEKRRQTKEDAVYGFVFESDSNSDDSGGSRRKKRRKTKPVKFSSAGNIDQVLKQNRGNCKIDEND 71

  Fly   297 FTFKPTERLGA-----------------WEEFTRGIGSKLMEKMGYIHGTGLGSDGRGIVTPVSA 344
            .|..|. .||.                 :|:|:.|||.||:||||| .|.|||.:.:|||.|:..
plant    72 DTILPI-ALGKKIADKAHVREKNNKKENFEKFSGGIGMKLLEKMGY-KGRGLGKNQQGIVAPIEV 134

  Fly   345 QILPQGRSLDACMELREAANGDKDY-------FSVERKLKRAQRR------------QRKADEKA 390
            |:.|:...:           |..|:       |....|::..::.            :|...:|.
plant   135 QLRPKNMGM-----------GYNDFKEKNAPLFPCLNKVEEKKKSVVVTVSENHGDGRRDLWKKK 188

  Fly   391 YVRESQRVDVFTFLNDSVLGPGESTQQGEQVTKKAKTNELQQHSTKTLNVETVRIADEIRRKQRD 455
            .||:...:....||       |:..::|              .....|.::.....|.:....|:
plant   189 NVRKEVYITAEEFL-------GKKQEEG--------------FGCDQLIIDKRGPQDRVVNSLRN 232

  Fly   456 MAKVKQSLDRNSGDAQLQKRLQVQMQSHKQELATLQ---AQERSLSKEQQTRKSKNKM 510
            :...:::.|.|....:||..|:..::|.:..:....   ..|:.|:...|..|.|.||
plant   233 LYAEEKATDANVQQPELQHNLRFIVKSLEHGILKTDKDLRNEKGLALSLQQEKEKFKM 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4709NP_001285788.1 ZnF_C3H1 155..176 CDD:214632
G-patch 312..355 CDD:279867 20/42 (48%)
AT2G42330NP_001078041.1 TIP_N <5..>52 CDD:372123 9/44 (20%)
G-patch 103..144 CDD:366717 20/52 (38%)
GCFC 323..587 CDD:369552
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1238995at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.