DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4709 and LIME1

DIOPT Version :10

Sequence 1:NP_609331.1 Gene:CG4709 / 34324 FlyBaseID:FBgn0032169 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_060276.2 Gene:LIME1 / 54923 HGNCID:26016 Length:295 Species:Homo sapiens


Alignment Length:54 Identity:13/54 - (24%)
Similarity:17/54 - (31%) Gaps:14/54 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   411 PGESTQQGEQVTKKAKTNELQQHSTKTLNVETVRIADEIRRKQRDMAKVKQSLD 464
            |.|..|...:||..|:.:.|.....|.              |:||.......||
Human   180 PQEPQQGKTEVTPAAQVDVLYSRVCKP--------------KRRDPGPTTDPLD 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4709NP_609331.1 ZnF_C3H1 155..176 CDD:214632
G-patch 312..355 CDD:396249
LIME1NP_060276.2 LIME1 27..259 CDD:480639 13/54 (24%)
Interaction with GRB2. /evidence=ECO:0000250 145..148
Interaction with CSK. /evidence=ECO:0000269|PubMed:14610046 167..170
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..192 4/11 (36%)
Interaction with CSK. /evidence=ECO:0000269|PubMed:14610046 200..203 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..223 6/30 (20%)
Interaction with LCK and PIK3R1. /evidence=ECO:0000250 235..238
Interaction with LCK, PLCG2 and PIK3R1. /evidence=ECO:0000250 254..257
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..295
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.