| Sequence 1: | NP_609331.1 | Gene: | CG4709 / 34324 | FlyBaseID: | FBgn0032169 | Length: | 513 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_060276.2 | Gene: | LIME1 / 54923 | HGNCID: | 26016 | Length: | 295 | Species: | Homo sapiens |
| Alignment Length: | 54 | Identity: | 13/54 - (24%) |
|---|---|---|---|
| Similarity: | 17/54 - (31%) | Gaps: | 14/54 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 411 PGESTQQGEQVTKKAKTNELQQHSTKTLNVETVRIADEIRRKQRDMAKVKQSLD 464 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4709 | NP_609331.1 | ZnF_C3H1 | 155..176 | CDD:214632 | |
| G-patch | 312..355 | CDD:396249 | |||
| LIME1 | NP_060276.2 | LIME1 | 27..259 | CDD:480639 | 13/54 (24%) |
| Interaction with GRB2. /evidence=ECO:0000250 | 145..148 | ||||
| Interaction with CSK. /evidence=ECO:0000269|PubMed:14610046 | 167..170 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 170..192 | 4/11 (36%) | |||
| Interaction with CSK. /evidence=ECO:0000269|PubMed:14610046 | 200..203 | 0/2 (0%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 204..223 | 6/30 (20%) | |||
| Interaction with LCK and PIK3R1. /evidence=ECO:0000250 | 235..238 | ||||
| Interaction with LCK, PLCG2 and PIK3R1. /evidence=ECO:0000250 | 254..257 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 261..295 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||