DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4709 and tfip11

DIOPT Version :9

Sequence 1:NP_001285788.1 Gene:CG4709 / 34324 FlyBaseID:FBgn0032169 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_001002721.1 Gene:tfip11 / 436994 ZFINID:ZDB-GENE-040718-479 Length:832 Species:Danio rerio


Alignment Length:334 Identity:80/334 - (23%)
Similarity:135/334 - (40%) Gaps:95/334 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 KERERDFKFEELYPLTTDQDEDDELSSEESNSSMN-----------------DNSSDEAESDMDD 282
            :.|.|..|.|..|.:..:||.|||..|.....:.:                 :..::...||..|
Zfish    39 RRRYRQTKEEATYGIWAEQDSDDERPSFGGKRAKDYSTPVSFVSAGLRKTAAEEKAEREGSDDSD 103

  Fly   283 LEEA----RRARMVELSL-FTFKPTER----------LGAWEEFTRGIGSKLMEKMGYIHGTGLG 332
            .|||    |.|...:|.. .:||.::|          ||.||:.|||||.||::||||:.|.|||
Zfish   104 AEEAPPPPRAAAPKKLQTGGSFKTSQRFAGGIRTGQDLGNWEKHTRGIGQKLLQKMGYVPGKGLG 168

  Fly   333 SDGRGIVTPVSAQILPQGRSLDACMELREAANGDKDYFSVERKLKRAQRRQRKADEKAYVRESQR 397
            .:.:|||.|:.|: |.:|:...............:|:..|:         ..:.:|:.:.:|.  
Zfish   169 KNAQGIVNPIEAK-LRKGKGAVGAYGSERTQQSLQDFPVVD---------SEEEEEEEFQKEL-- 221

  Fly   398 VDVFTFLNDSVLGPGESTQQGEQVTKKAK-----TNELQQHSTKTLNVETVRIADEIRR-KQRDM 456
                          |:..::.....||.|     .::|:.|.|:. |:...|.|.|:.: |..||
Zfish   222 --------------GQWRKEPGTAKKKPKYSYRTVDDLKAHGTRA-NMSMSRPAGELAQVKVIDM 271

  Fly   457 AKVKQSL-------------------------DRNSGDA--QLQKRLQVQMQSHKQELATLQAQE 494
            ...:|.:                         .::||.|  :|:..|::.::..:|::  ||: .
Zfish   272 TGREQKVYNSYSHMSQKHSVPEEAPLSVSTREQKSSGFALPELEHNLKLLIELTEQDI--LQS-A 333

  Fly   495 RSLSKEQQT 503
            |.|..|:.|
Zfish   334 RLLQHEKDT 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4709NP_001285788.1 ZnF_C3H1 155..176 CDD:214632
G-patch 312..355 CDD:279867 22/42 (52%)
tfip11NP_001002721.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
TIP_N 23..103 CDD:289242 13/63 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..145 25/105 (24%)
G-patch 148..192 CDD:279867 22/44 (50%)
GCFC 390..659 CDD:285127
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1238995at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.