DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4709 and stip-1

DIOPT Version :9

Sequence 1:NP_001285788.1 Gene:CG4709 / 34324 FlyBaseID:FBgn0032169 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_496226.2 Gene:stip-1 / 174600 WormBaseID:WBGene00007412 Length:830 Species:Caenorhabditis elegans


Alignment Length:312 Identity:70/312 - (22%)
Similarity:119/312 - (38%) Gaps:85/312 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 DEDDELSSEESNSSMNDNSSDEAESDMDDLEEARRARMVELSLFTFKPTERLGA----------- 307
            |:||.       :|:|.|...|.:...||    ..:..::....|.|..::.||           
 Worm    82 DKDDP-------ASLNLNLGGEKKPKEDD----EGSIQIDFDKRTKKAPKQNGAQVFAGMRSSAN 135

  Fly   308 --------WEEFTRGIGS-----KLMEKMGYIHGTGLGSDGRGIVTPVSAQILPQGRSLDACMEL 359
                    :..:.||.|:     |:|:.|||..|.|||:.|:|||.||.|| |.:||........
 Worm   136 HGAADINQFGSWMRGDGNSNKIMKMMQAMGYKPGEGLGAQGQGIVEPVQAQ-LRKGRGAVGAYGK 199

  Fly   360 REAANGDKDYFSVERKLKR------AQRRQRKADEKAYV------RESQRVDV-FTFLNDSVLGP 411
            ...|.|.|...|.....||      :.|......||:.:      ::||.|.. :..:.|.:   
 Worm   200 ESTATGPKFGESAADAQKRMAQEGTSSRPTNDDQEKSGLKIKGSWKKSQTVKTKYRTIEDVM--- 261

  Fly   412 GESTQQGEQVTKKAKTNELQQHSTKTLNVETVRIADEIRRKQR-----DMAKVKQSLDRNSGDAQ 471
                ::|...::.|...:.||:|       .:::.|...::|:     |...:|...:.::.|.:
 Worm   262 ----EEGMSASRPASHQQSQQYS-------NIKVIDMTGKQQKIYSGYDSFSMKTRSEYDTVDDE 315

  Fly   472 LQKRLQVQMQSH----------------KQELATLQAQERSLSKE-QQTRKS 506
            .:....|....|                .|:|.:|:.|..:|..: ||.:||
 Worm   316 ERTVFDVPELIHNLNLLVDLTEEGIRRSNQQLISLKDQTTALEYDLQQVQKS 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4709NP_001285788.1 ZnF_C3H1 155..176 CDD:214632
G-patch 312..355 CDD:279867 23/47 (49%)
stip-1NP_496226.2 TIP_N 4..104 CDD:289242 9/32 (28%)
G-patch 154..197 CDD:279867 20/43 (47%)
DUF1319 310..>411 CDD:284451 12/58 (21%)
GCFC 397..673 CDD:285127
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1238995at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.