DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13126 and CG31648

DIOPT Version :9

Sequence 1:NP_001285787.1 Gene:CG13126 / 34323 FlyBaseID:FBgn0032168 Length:463 Species:Drosophila melanogaster
Sequence 2:NP_723086.1 Gene:CG31648 / 33776 FlyBaseID:FBgn0051648 Length:241 Species:Drosophila melanogaster


Alignment Length:191 Identity:37/191 - (19%)
Similarity:62/191 - (32%) Gaps:78/191 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 EEIENKKRIVIEEVNTKMPLDRLATL----DEDEAERWRRK-RELEINKRLGQRIYAWKRIEYGA 156
            |::|:.|:|.          ||:..:    |...:.||..| ::.||....|:            
  Fly    95 EKVEHMKKIE----------DRVLKIRFNADIGSSMRWNFKPQQYEIKVAPGE------------ 137

  Fly   157 YESLVYAIARGAQEYAVLKRVLTELAQRDEQFRPRSFFDFGSGIGTGMWVASELWREHIFEYYNV 221
             .:|.:..||...:..|:                        ||.|                |||
  Fly   138 -TALAFYTARNPTDKPVI------------------------GIST----------------YNV 161

  Fly   222 ---DRSREMNEISELILRDGHEN--KQIALRNVFYRQ----FLPAIETNYDLVIISHTLFE 273
               :.....|:|......:...|  :::.:...||..    ..||:|| .|.:.:|:|.||
  Fly   162 IPFEAGAYFNKIQCFCFEEQQLNPHEEVDMPVFFYIDPEITADPALET-CDTITLSYTFFE 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13126NP_001285787.1 Rsm22 156..441 CDD:286344 24/127 (19%)
CG31648NP_723086.1 CtaG_Cox11 71..221 CDD:282318 35/189 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447733
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.