DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5853 and Abca7

DIOPT Version :9

Sequence 1:NP_001260309.1 Gene:CG5853 / 34322 FlyBaseID:FBgn0032167 Length:689 Species:Drosophila melanogaster
Sequence 2:NP_001334010.1 Gene:Abca7 / 27403 MGIID:1351646 Length:2167 Species:Mus musculus


Alignment Length:332 Identity:91/332 - (27%)
Similarity:144/332 - (43%) Gaps:55/332 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PPPIPTPPQVNYTNGNEPSKQPPLEPVVEE-EVHFDTDALNNLPAREPVDMEFKELSLT-VKLGF 118
            |.|...|.:.:|..|..|.|...|.|..:: :|..:...|..:|.          :|:. :|..|
Mouse   759 PEPWNFPFRRSYWCGPGPPKSSVLAPAPQDPKVLVEEPPLGLVPG----------VSIRGLKKHF 813

  Fly   119 NRGSKEILHNVCGKFPGSQLIAIMGPSGAGKSTLLDALSG-FKTTGVDGSILLNGRRRDLPSFRR 182
            ....:..|..:...|....:.|.:|.:||||:|.|..||| |..:....|||.:..:.::.:.|.
Mouse   814 RGCPQPALQGLNLDFYEGHITAFLGHNGAGKTTTLSILSGLFPPSSGSASILGHDVQTNMAAIRP 878

  Fly   183 MSCYITQDDRLQPLLTVNENMHIAADLK-LGQTVSYEEKESRIEDILLLLGLYNHDQTLTMRLSG 246
            ......|.:.|..:|||.|::.....|| :.......|:|..|.|:    ||.....|.|..|||
Mouse   879 HLGICPQYNVLFDMLTVEEHVWFYGRLKGVSAAAMGPERERLIRDV----GLTLKRDTQTRHLSG 939

  Fly   247 GQKKRLSIAMELINNPTVMFLDEPTTGLDSSSCTKVLELLKKLTSQGRT-IICTIHQPTAKLFQI 310
            |.:::||:|:..:....|:.:||||.|:|.:|...:.|||.|. .:||| |:.|.|...|:|  :
Mouse   940 GMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLLKY-REGRTLILSTHHLDEAEL--L 1001

  Fly   311 FDQVYVLSAGNCVYQGSTQKLVPFLQSVDLPCPMY---HNPADYIIELACGEYGYDKVDTLKLAT 372
            .|:|.:::.|:....||               |::   |        |.||.|       |.|..
Mouse  1002 GDRVAMVAGGSLCCCGS---------------PLFLRRH--------LGCGYY-------LTLVK 1036

  Fly   373 ENGSCLT 379
            .:.|.:|
Mouse  1037 SSQSLVT 1043

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5853NP_001260309.1 3a01204 97..689 CDD:273361 80/290 (28%)
ABCG_EPDR 102..326 CDD:213180 67/227 (30%)
ABC2_membrane 420..623 CDD:279410
Abca7NP_001334010.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1042..1088 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1172..1192
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2126..2167
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.