DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5853 and abt-2

DIOPT Version :9

Sequence 1:NP_001260309.1 Gene:CG5853 / 34322 FlyBaseID:FBgn0032167 Length:689 Species:Drosophila melanogaster
Sequence 2:NP_490949.3 Gene:abt-2 / 171782 WormBaseID:WBGene00000020 Length:2146 Species:Caenorhabditis elegans


Alignment Length:407 Identity:97/407 - (23%)
Similarity:162/407 - (39%) Gaps:89/407 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 VEEEVHFDTDALNNLPAREPVDMEFKELSLTVKLG-----FNRGSKEI------LHNVCGKFPGS 136
            |::| ||||     :|..:..|.|...|:|.|.:.     :..|:|.:      |:.       .
 Worm   904 VDDE-HFDT-----IPNSDSFDSEPTNLTLAVHINSMSKVYENGTKALDCLNLRLYE-------G 955

  Fly   137 QLIAIMGPSGAGKSTLLDALSG-FKTTGVDGSILLNGRRRDLPSFRRMSCYITQDDRLQPLLTVN 200
            |:..::|.:||||:|.:..|.| :..:.....|.....|.||...|.:.....|.:.|...|||:
 Worm   956 QITGLLGHNGAGKTTTMSILCGLYAPSSGTAKIYQRDIRTDLRRVRDVLGICPQHNVLFSHLTVS 1020

  Fly   201 ENMHIAADLKLGQTVSYEEKESRIEDILLLLGLYNHDQTLTMRLSGGQKKRLSIAMELINNPTVM 265
            |.:.:.|.||   .|...|..|::::||..:.|......|...||||.|:||.|.:..|.....:
 Worm  1021 EQLRLFAALK---GVPDSELTSQVDEILASVSLTEKANKLASTLSGGMKRRLCIGIAFIGGSRFV 1082

  Fly   266 FLDEPTTGLDSSSCTKVLELLKKLTSQGRTIICTIH---------QPTAKLFQIFDQVYVLSAGN 321
            .|||||.|:|.::...:.:||:: ..:||||:.:.|         ...|.|.|.|::..:|....
 Worm  1083 ILDEPTAGVDVTARKDIWKLLQR-NKEGRTILLSTHHMDEADVLSDRIAILSQDFEKPDLLDGKR 1146

  Fly   322 CVYQG-------------------STQKLVP-FLQSV--------------DLPCPMYHNPADYI 352
            .::|.                   ..|.::| ||.::              ||...|...|.:..
 Worm  1147 LIFQHFYALLVCRINYTLKSKRTFLFQVIIPLFLLALAELFVLLQVSTARPDLMVSMPPLPLETS 1211

  Fly   353 IELACGEYGYDKVDTLKLATENGSCLTWFHNPSA--------------VLRAEVLMR-KYPIPKK 402
            |.....::..:..||.:.:|.|......|.:|..              .:|.|::.| :|...:.
 Worm  1212 IMGNHSDFYVNSWDTAENSTANDILHAMFSSPGTGPRCAKDVPNDLLDTMRRELMFRNRYGFGRN 1276

  Fly   403 TKSRSLEDTSYSN--QC 417
            ..:..::..|..|  ||
 Worm  1277 KPAPGVDKDSVDNEYQC 1293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5853NP_001260309.1 3a01204 97..689 CDD:273361 91/393 (23%)
ABCG_EPDR 102..326 CDD:213180 66/244 (27%)
ABC2_membrane 420..623 CDD:279410
abt-2NP_490949.3 rim_protein 39..2117 CDD:130324 97/407 (24%)
ABC_subfamily_A 929..1134 CDD:213230 59/215 (27%)
ABC_subfamily_A 1802..2024 CDD:213230
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.