DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5853 and abca1

DIOPT Version :9

Sequence 1:NP_001260309.1 Gene:CG5853 / 34322 FlyBaseID:FBgn0032167 Length:689 Species:Drosophila melanogaster
Sequence 2:XP_004910916.1 Gene:abca1 / 100491942 XenbaseID:XB-GENE-1001143 Length:2311 Species:Xenopus tropicalis


Alignment Length:365 Identity:98/365 - (26%)
Similarity:162/365 - (44%) Gaps:72/365 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 IPTPPQVNYTNG----------NEPS--KQPPLEPVVEEEVHFDTDALNNLPAREPVDMEFKELS 111
            ||.|....:|..          |:|.  ::...|..:|||           |:..|:.:..:.| 
 Frog   856 IPRPWYFPFTKSYWCGEECKEYNQPHTVQKGSSEVCMEEE-----------PSHLPLGVSIQNL- 908

  Fly   112 LTVKLGFNRGSKEILHNVCGKFPGSQLIAIMGPSGAGKSTLLDALSGF--KTTGVDGSILLNGRR 174
              ||: :..|.|..:..:...|...|:.:.:|.:||||:|.:..|:|.  .|||. ..|:....|
 Frog   909 --VKI-YRNGKKVAVDGLTLNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTTGT-AYIMKKDIR 969

  Fly   175 RDLPSFRRMSCYITQDDRLQPLLTVNENMHIAADLKLGQTVSYEEKESRIEDILLLLGLYNHDQT 239
            .:|.|.|:......|.:.|...|||.|::...|.||   .:|.|:.::.:|.::..:||.:..:.
 Frog   970 TELNSIRQNLGVCPQHNVLFDALTVEEHIWFYARLK---GLSEEKVKAEMEQMVNDVGLPHKKKY 1031

  Fly   240 LTMRLSGGQKKRLSIAMELINNPTVMFLDEPTTGLDSSSCTKVLELLKKLTSQGRTII-CTIHQP 303
            .|.:||||.:::||:|:..:....|:.|||||.|:|..|...:.|||.|. .|||||| .|.|..
 Frog  1032 KTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLIKY-RQGRTIILSTHHMD 1095

  Fly   304 TAKLFQIFDQVYVLSAGNCVYQGSTQKLVPFLQSVDLPCPMYHNPADYIIELACGEYGYDKVDTL 368
            .|.:  :.|::.::|.|.....||:.    ||::                :|..|.|       |
 Frog  1096 EADI--LGDRIAIISHGKLCCVGSSL----FLKN----------------QLGTGYY-------L 1131

  Fly   369 KLA-TENGSCLTWFHNPSAVL-------RAEVLMRKYPIP 400
            .|. .:|.|.|:...|.|:.:       ..:...:::|.|
 Frog  1132 TLVKRDNDSSLSSCRNSSSTMSYLKKESSKQTACKQHPSP 1171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5853NP_001260309.1 3a01204 97..689 CDD:273361 88/315 (28%)
ABCG_EPDR 102..326 CDD:213180 71/226 (31%)
ABC2_membrane 420..623 CDD:279410
abca1XP_004910916.1 rim_protein 1..2272 CDD:130324 98/365 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.