DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31712 and AT5G13340

DIOPT Version :9

Sequence 1:NP_609327.3 Gene:CG31712 / 34320 FlyBaseID:FBgn0051712 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_196838.1 Gene:AT5G13340 / 831175 AraportID:AT5G13340 Length:242 Species:Arabidopsis thaliana


Alignment Length:291 Identity:90/291 - (30%)
Similarity:146/291 - (50%) Gaps:66/291 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SRTPSPSGKRRHHKSKHKKRSKSHHDHERPSTRTDRDKSSEVNNHGRHRERDRDRERDRHRSDRH 69
            ||:.|||.:||:.:|              |.|                           |||.|.
plant     6 SRSRSPSHRRRYSRS--------------PVT---------------------------HRSSRR 29

  Fly    70 TERDYRHSPSILKSRKRSSSSSSDSQYSEQESQRSKQKRSRFKKLD-EQNQMQVERLAEMERQRR 133
            |.||...||  ..||.:.|.|.:..|:          :|.|...|. .::::.:|...|.|.:.|
plant    30 TRRDRSRSP--YTSRHKKSRSPAPRQH----------QRDRSSSLSPSEHRIAIEVKKEQEDKAR 82

  Fly   134 AK-ELEQKTIEEEAAKRIEMLVKKRVEEELEKRRDEIEQEVNRRVETAKAEMEREMMLELERRRE 197
            .: |.|.|.:|||.|:|||..|:|.|||.:  :.:|:::|:.||.:.|..:|..::.::|::.:|
plant    83 LQHEAELKRLEEETAQRIEEAVRKNVEERM--KTEEVKEEIERRTKEAYEKMFLDVEIQLKKEKE 145

  Fly   198 QIREEERRREEDEKQKREELEEILAENNRKIEEAQRKLA-------EERLAIIE-EQRLMDEERQ 254
            ....|.||:||..:::||||:::|.||:|::||:||:.|       |||...:| .||..:|..:
plant   146 AALNEARRKEEQARREREELDKMLEENSRRVEESQRREAMELQRKEEERYRELELLQRQKEEAAR 210

  Fly   255 RMRKEQEKRVKEEQKVILGKNNSRPKLSFSL 285
            |.:.|:|:.::...|:..| |.||.||.|.:
plant   211 RKKLEEEEEIRNSSKLSNG-NRSRSKLHFGM 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31712NP_609327.3 ARGLU 135..285 CDD:405931 59/158 (37%)
AT5G13340NP_196838.1 ARGLU 85..240 CDD:405931 59/157 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 112 1.000 Domainoid score I2061
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I1668
OMA 1 1.010 - - QHG60126
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2617
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR31711
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.