DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31712 and ARGLU1

DIOPT Version :9

Sequence 1:NP_609327.3 Gene:CG31712 / 34320 FlyBaseID:FBgn0051712 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_060481.3 Gene:ARGLU1 / 55082 HGNCID:25482 Length:273 Species:Homo sapiens


Alignment Length:301 Identity:144/301 - (47%)
Similarity:191/301 - (63%) Gaps:46/301 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MG-SRSRTPSPSGKRRHHKSKHKKRSKSHHDHERPSTRTDRDKSSEVNNHGRHRERDRDRERDRH 64
            || ||||:.|        :|||.|.||  |:.:|                .|.|.|.||:||.|.
Human     1 MGRSRSRSSS--------RSKHTKSSK--HNKKR----------------SRSRSRSRDKERVRK 39

  Fly    65 RS-DRHTERDYRHSPSILKSRKRSSSSSSDSQYSEQESQRSKQKRSRF----------KKLDE-Q 117
            || .|.::|:.|.     :||.||.|:::.....|::.:|:.....|.          ..||| |
Human    40 RSKSRESKRNRRR-----ESRSRSRSTNTAVSRRERDRERASSPPDRIDIFGRTVSKRSSLDEKQ 99

  Fly   118 NQMQVERLAEMERQR--RAKELEQKTIEEEAAKRIEMLVKKRVEEELEKRRDEIEQEVNRRVETA 180
            .:.:.|:.||.||||  |.:|:|:|.||||.|:|:|.||.||||||||||:||||:||.||||.|
Human   100 KREEEEKKAEFERQRKIRQQEIEEKLIEEETARRVEELVAKRVEEELEKRKDEIEREVLRRVEEA 164

  Fly   181 KAEMEREMMLELERRREQIREEERRREEDEKQKREELEEILAENNRKIEEAQRKLAEERLAIIEE 245
            |..||::::.||||:|:.....::.|||:|:.||||||.||.||||||.|||.|||||:|.|:||
Human   165 KRIMEKQLLEELERQRQAELAAQKAREEEERAKREELERILEENNRKIAEAQAKLAEEQLRIVEE 229

  Fly   246 QRLMDEERQRMRKEQEKRVKEEQKVILGKNNSRPKLSFSLK 286
            ||.:.|||.::.:|::::.|||||:||||..||||||||||
Human   230 QRKIHEERMKLEQERQRQQKEEQKIILGKGKSRPKLSFSLK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31712NP_609327.3 ARGLU 135..285 CDD:405931 93/149 (62%)
ARGLU1NP_060481.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..113 44/142 (31%)
ARGLU 130..269 CDD:405931 86/138 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..273 20/33 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158684
Domainoid 1 1.000 186 1.000 Domainoid score I3372
eggNOG 1 0.900 - - E1_2BZMG
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 227 1.000 Inparanoid score I3495
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60126
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006307
OrthoInspector 1 1.000 - - oto91778
orthoMCL 1 0.900 - - OOG6_107421
Panther 1 1.100 - - LDO PTHR31711
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4802
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.