DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31712 and arglu1

DIOPT Version :9

Sequence 1:NP_609327.3 Gene:CG31712 / 34320 FlyBaseID:FBgn0051712 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_989280.1 Gene:arglu1 / 394894 XenbaseID:XB-GENE-5857929 Length:265 Species:Xenopus tropicalis


Alignment Length:300 Identity:141/300 - (47%)
Similarity:188/300 - (62%) Gaps:52/300 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MG-SRSRTPSPSGKRRHHKSKHKKRSKSHHDHERPSTRTDRDKSSEVNNHGRHRERDRDRERDRH 64
            || ||||:.|        :|||.|..|                      |.:.|.|.|::||.|.
 Frog     1 MGRSRSRSSS--------RSKHAKSGK----------------------HNKKRSRSREKERVRK 35

  Fly    65 RS-DRHTERDYRHSPSILKSRKRSSSSSSDSQYSEQESQ---------RSKQKRSRFKKLDE-QN 118
            || .|.::|:.|.     :||.||.|:::..:..|:.:.         |:..|||   .||| |.
 Frog    36 RSKSRESKRNRRR-----ESRSRSRSNTASRRERERAASPPDRIDIFGRTVSKRS---SLDEKQK 92

  Fly   119 QMQVERLAEMERQRRAK--ELEQKTIEEEAAKRIEMLVKKRVEEELEKRRDEIEQEVNRRVETAK 181
            :...|:.||.|||||.:  |:|:|.||||.|:|:|.||.||||||||||:||||:||.||||.||
 Frog    93 REDEEKKAEYERQRRIRQQEIEEKLIEEETARRVEELVAKRVEEELEKRKDEIEREVLRRVEEAK 157

  Fly   182 AEMEREMMLELERRREQIREEERRREEDEKQKREELEEILAENNRKIEEAQRKLAEERLAIIEEQ 246
            ..||::::.||||:|:.....::.|||:|:.||||||.||.||||||.:||.|||||:|.|:|||
 Frog   158 RIMEKQLLEELERQRQAELAAQKAREEEERAKREELERILEENNRKIADAQAKLAEEQLKIVEEQ 222

  Fly   247 RLMDEERQRMRKEQEKRVKEEQKVILGKNNSRPKLSFSLK 286
            |.:.|||.::.:|::::.|||||:||||..||||||||||
 Frog   223 RKIHEERMKLEQERQRQQKEEQKIILGKGKSRPKLSFSLK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31712NP_609327.3 ARGLU 135..285 CDD:405931 92/151 (61%)
arglu1NP_989280.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..106 43/142 (30%)
ARGLU 122..252 CDD:291991 78/129 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..265 20/33 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3332
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 222 1.000 Inparanoid score I3446
OMA 1 1.010 - - QHG60126
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006307
OrthoInspector 1 1.000 - - oto105535
Panther 1 1.100 - - LDO PTHR31711
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4802
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.100

Return to query results.
Submit another query.