DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31712 and Arglu1

DIOPT Version :9

Sequence 1:NP_609327.3 Gene:CG31712 / 34320 FlyBaseID:FBgn0051712 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001020143.1 Gene:Arglu1 / 290912 RGDID:1310061 Length:271 Species:Rattus norvegicus


Alignment Length:299 Identity:146/299 - (48%)
Similarity:192/299 - (64%) Gaps:44/299 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MG-SRSRTPSPSGKRRHHKSKHKKRSKSHHDHERPSTRTDRDKSSEVNNHGRHRERDRDRERDRH 64
            || ||||:.|        :|||.|.||  |:.:|                .|.|.|.||:||.|.
  Rat     1 MGRSRSRSSS--------RSKHTKSSK--HNKKR----------------SRSRSRSRDKERVRK 39

  Fly    65 RS-DRHTERDYRHSPSILKSRKRSSSSSSDSQYSEQESQRSKQKR--------SRFKKLDE-QNQ 119
            || .|.::|:.|.     :||.||.|:::.:...|:|...|...|        |:...||| |.:
  Rat    40 RSKSRESKRNRRR-----ESRSRSRSTNAAASRRERERASSPPDRIDIFGRTVSKRSSLDEKQKR 99

  Fly   120 MQVERLAEMERQR--RAKELEQKTIEEEAAKRIEMLVKKRVEEELEKRRDEIEQEVNRRVETAKA 182
            .:.|:.||.||||  |.:|:|:|.||||.|:|:|.||.||||||||||:||||:||.||||.||.
  Rat   100 EEEEKKAEFERQRKIRQQEIEEKLIEEETARRVEELVAKRVEEELEKRKDEIEREVLRRVEEAKR 164

  Fly   183 EMEREMMLELERRREQIREEERRREEDEKQKREELEEILAENNRKIEEAQRKLAEERLAIIEEQR 247
            .||::::.||||:|:.....::.|||:|:.||||||.||.||||||.|||.|||||:|.|:||||
  Rat   165 IMEKQLLEELERQRQAELAAQKAREEEERAKREELERILEENNRKIAEAQAKLAEEQLRIVEEQR 229

  Fly   248 LMDEERQRMRKEQEKRVKEEQKVILGKNNSRPKLSFSLK 286
            .:.|||.::.:|::::.|||||:||||..||||||||||
  Rat   230 KIHEERMKLEQERQRQQKEEQKIILGKGKSRPKLSFSLK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31712NP_609327.3 ARGLU 135..285 CDD:405931 93/149 (62%)
Arglu1NP_001020143.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..112 47/141 (33%)
ARGLU 128..267 CDD:405931 86/138 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 236..271 20/33 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352693
Domainoid 1 1.000 186 1.000 Domainoid score I3280
eggNOG 1 0.900 - - E1_2BZMG
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 228 1.000 Inparanoid score I3388
OMA 1 1.010 - - QHG60126
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006307
OrthoInspector 1 1.000 - - oto98845
orthoMCL 1 0.900 - - OOG6_107421
Panther 1 1.100 - - LDO PTHR31711
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.800

Return to query results.
Submit another query.