DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31712 and F44E2.3

DIOPT Version :9

Sequence 1:NP_609327.3 Gene:CG31712 / 34320 FlyBaseID:FBgn0051712 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_498950.1 Gene:F44E2.3 / 176242 WormBaseID:WBGene00018417 Length:244 Species:Caenorhabditis elegans


Alignment Length:305 Identity:87/305 - (28%)
Similarity:140/305 - (45%) Gaps:87/305 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSRSRTPSPSGKRRHHKSKHKKRSKSHHDHERPSTRTDRDKSSEVNNHGRHRERDRDRERDRHR 65
            |..|||:.|.|.||                        ||::..      |..:|||||||.|.|
 Worm     1 MSRRSRSRSRSPKR------------------------DREERK------RREDRDRDRERKRDR 35

  Fly    66 SDRHTERDYRHSPSILKSRKRSSSSSSDSQYSEQ-----ESQRSKQKRSRFKKL----------- 114
            .||  ||..||         |||||........|     ..:|.:::|:...||           
 Worm    36 KDR--ERKRRH---------RSSSSEGSQAEPHQLGSIFREERRRRERNESPKLPPPPPPPPSDP 89

  Fly   115 --DEQNQMQVERLAEMERQRRAKELEQKTIEEEAAKRIEMLVKKRVEEELEKRRDEIEQEVNRRV 177
              |......|..|.|..:    |.||:|.:|:.:| |:..| :..:.|:....|:|:|:.:    
 Worm    90 PVDTSIPFDVSTLNEPTK----KWLEEKIVEQVSA-RVHQL-EAMMAEKATSARNEMEKML---- 144

  Fly   178 ETAKAEMEREMMLELERRREQIREEERRREEDEKQKREELEEILAENNRKI---EEAQRKLAEER 239
               :|::|.||.:||        .|.::|:|:.::|.::||   ||..||:   ||:::|..|:|
 Worm   145 ---RAQIEAEMAVEL--------AECKKRDEESRKKCKQLE---AELERKVLEAEESRKKFEEDR 195

  Fly   240 LAIIEEQRLMDEERQRMRKEQEKRVKEEQKVILGKN-NSRPKLSF 283
            ||::|::..::.:|..:.:::....|.||:.||.|: |||..:.|
 Worm   196 LAMLEQKSQLERDRAELARQKSDMKKNEQQAILNKSGNSRAPIKF 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31712NP_609327.3 ARGLU 135..285 CDD:405931 47/153 (31%)
F44E2.3NP_498950.1 ARGLU 102..231 CDD:291991 44/152 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60126
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107421
Panther 1 1.100 - - LDO PTHR31711
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.