DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42366 and p38a

DIOPT Version :9

Sequence 1:NP_723501.2 Gene:CG42366 / 34319 FlyBaseID:FBgn0259712 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_001163711.1 Gene:p38a / 42866 FlyBaseID:FBgn0015765 Length:366 Species:Drosophila melanogaster


Alignment Length:310 Identity:109/310 - (35%)
Similarity:166/310 - (53%) Gaps:30/310 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YITLTQLGDGTYGTVVLGQRKDTGEKVAIKRMKRKYYSWEEA-MNLREVKSLKKLSHPNIVKLKE 67
            |..|..:|.|.||.|.....:.|...||||::.|.:.|...| ...||::.||.:.|.|::.|.:
  Fly    25 YQDLQPVGSGAYGQVSKAVVRGTNMHVAIKKLARPFQSAVHAKRTYRELRLLKHMDHENVIGLLD 89

  Fly    68 VIR--------EN-DTLYFVFEYMKENLYQMIKDRDTHLPEPELKSILFQVLTGLAFMHRHGFFH 123
            :..        || ..:|.|...|..:|..:|  |..||.:..::.:::|:|.||.::|..|..|
  Fly    90 IFHPHPANGSLENFQQVYLVTHLMDADLNNII--RMQHLSDDHVQFLVYQILRGLKYIHSAGVIH 152

  Fly   124 RDLKPENLLCSGPDLIKIADFGLAREIRSRPPFTDYVSTRWYRAPEVLLHSTNYGSTIDLWAMGC 188
            |||||.|:..:....::|.||||||...:.  .|.||:||||||||::|:..:|..|:|:|::||
  Fly   153 RDLKPSNIAVNEDCELRILDFGLARPTENE--MTGYVATRWYRAPEIMLNWMHYDQTVDIWSVGC 215

  Fly   189 IMAELYTFRPLFPGSSEVDQLFKICSVLGTPDKDDWPDGY--RLASMIHFRY----PDCIKVPLS 247
            |||||.|.|.||||:..:.||..|..:||||     |..:  :::|.....|    |........
  Fly   216 IMAELITRRTLFPGTDHIHQLNLIMEMLGTP-----PAEFLKKISSESARSYIQSLPPMKGRSFK 275

  Fly   248 SVVSRCSQNGLDLLEDMLAYDPDKRPTAQQSLKYPYFH-----ALKRISP 292
            :|....:...:||||.||..|.:||.||:::|.:||..     ::::.||
  Fly   276 NVFKNANPLAIDLLEKMLELDAEKRITAEEALSHPYLEKYAEPSVEQTSP 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42366NP_723501.2 STKc_MAK_like 4..284 CDD:270824 106/295 (36%)
S_TKc 4..284 CDD:214567 106/295 (36%)
p38aNP_001163711.1 STKc_p38 9..354 CDD:143356 109/310 (35%)
S_TKc 25..312 CDD:214567 106/295 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442158
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.