DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42366 and rl

DIOPT Version :9

Sequence 1:NP_723501.2 Gene:CG42366 / 34319 FlyBaseID:FBgn0259712 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster


Alignment Length:297 Identity:107/297 - (36%)
Similarity:167/297 - (56%) Gaps:24/297 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RYITLTQLGDGTYGTVVLGQRKDTGEKVAIKRMKRKYYSWEEAMNLREVKSLKKLSHPNIVKLKE 67
            |||.|..:|:|.||.||......|.::||||::....:.......|||:..|.:..|.||:.:::
  Fly    37 RYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKISPFEHQTYCQRTLREITILTRFKHENIIDIRD 101

  Fly    68 VIREND-----TLYFVFEYMKENLYQMIKDRDTHLPEPELKSILFQVLTGLAFMHRHGFFHRDLK 127
            ::|.:.     .:|.|...|:.:||:::|.:  .|....:...|:|:|.||.::|.....|||||
  Fly   102 ILRVDSIDQMRDVYIVQCLMETDLYKLLKTQ--RLSNDHICYFLYQILRGLKYIHSANVLHRDLK 164

  Fly   128 PENLLCSGPDLIKIADFGLAR----EIRSRPPFTDYVSTRWYRAPEVLLHSTNYGSTIDLWAMGC 188
            |.|||.:....:||.||||||    |.......|:||:||||||||::|:|..|..:||:|::||
  Fly   165 PSNLLLNKTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGC 229

  Fly   189 IMAELYTFRPLFPGSSEVDQLFKICSVLGTPDKDDWPDGYRLASMIHFRYPDCIK-------VPL 246
            |:||:.:.||:|||...:|||..|..|||:|.:||      |..:|:.:..:.::       ||.
  Fly   230 ILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDD------LECIINEKARNYLESLPFKPNVPW 288

  Fly   247 SSVVSRCSQNGLDLLEDMLAYDPDKRPTAQQSLKYPY 283
            :.:........||||..||.::|.||...:::|.:||
  Fly   289 AKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPY 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42366NP_723501.2 STKc_MAK_like 4..284 CDD:270824 106/296 (36%)
S_TKc 4..284 CDD:214567 106/296 (36%)
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 107/297 (36%)
S_TKc 38..326 CDD:214567 106/296 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442156
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.