DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42366 and p38c

DIOPT Version :9

Sequence 1:NP_723501.2 Gene:CG42366 / 34319 FlyBaseID:FBgn0259712 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster


Alignment Length:352 Identity:109/352 - (30%)
Similarity:176/352 - (50%) Gaps:52/352 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LGDGTYGTVVLGQRKDTGEKVAIKRMKRKYYSWEEAM-NLREVKSLKKLSHPNIVKLKEV----- 68
            ||.|::|.|...:.:.|....|:||:.|.:...|:|. ..||::.||.::|.|::.|..|     
  Fly    26 LGGGSFGQVAKVRLRGTENYFAMKRLMRPFEREEDAKGTYREIRLLKHMNHRNVISLLNVFHPPA 90

  Fly    69 --IRENDTLYFVFEYMKENLYQMIKDRDTHLPEPELKSILFQVLTGLAFMHRHGFFHRDLKPENL 131
              :.|...:|.|...|..:|::.  .|...:.:.|::.||:|:|.||.::|..|..||||||.|:
  Fly    91 HNMMEFQQVYLVTHLMDADLHRY--SRSKRMSDQEIRIILYQILRGLKYIHSAGVVHRDLKPCNI 153

  Fly   132 LCSGPDLIKIADFGLAREIRSRPPFTDYVSTRWYRAPEVLLHSTNYGSTIDLWAMGCIMAELYTF 196
            ..:|...::|.||||:|....:  .||:|.|.||.|||::.....|...||:|::|||:|||.|.
  Fly   154 AVNGNSEVRILDFGLSRMCADK--MTDHVGTMWYLAPEIIFLRGQYTKAIDVWSVGCILAELITD 216

  Fly   197 RPLFPGSSEVDQLFKICSVLGTPDKD-----------DWPDGYRLASMIHFRYPDCIKVPLSSVV 250
            |.||.|.:.|.|:..:.:::|||.::           ::.:||.|.....|.:          :.
  Fly   217 RVLFRGENYVSQIRCLINIMGTPTREFITGISMERSRNYLEGYPLRQRCDFHH----------LF 271

  Fly   251 SRCSQNGLDLLEDMLAYDPDKRPTAQQSLKYPYFHALKRISPTAATKANVRLNSKYAASNGHPV- 314
            .......:||:|.||...|:||.||.:::.:||...|  |.|            .:.|.:..|| 
  Fly   272 MGYDVQAIDLMEKMLEMVPEKRITAAEAMLHPYLRDL--IEP------------HHHAEDTAPVY 322

  Fly   315 -QSVSNNVLPVQEKLQAVTELLHQTNN 340
             |:..|.||||:...:.|:   |:..|
  Fly   323 DQNFENMVLPVKCWKELVS---HEIRN 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42366NP_723501.2 STKc_MAK_like 4..284 CDD:270824 93/292 (32%)
S_TKc 4..284 CDD:214567 93/292 (32%)
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 109/352 (31%)
S_TKc 20..305 CDD:214567 93/292 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442162
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.