DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42366 and F52B5.2

DIOPT Version :9

Sequence 1:NP_723501.2 Gene:CG42366 / 34319 FlyBaseID:FBgn0259712 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_492259.1 Gene:F52B5.2 / 172614 WormBaseID:WBGene00009921 Length:301 Species:Caenorhabditis elegans


Alignment Length:314 Identity:89/314 - (28%)
Similarity:141/314 - (44%) Gaps:57/314 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VVLG------QRKDTGE--------------KVAIKRMKRKYYSWEEAMNLREVKSLKKL-SHPN 61
            |:||      |..|:||              :|.||..|..|  .|:     |:|.|..| :|..
 Worm    13 VILGGCTLRRQLNDSGEAMVFLAESGNEEKKEVIIKFFKCGY--GED-----EIKYLDVLTNHEQ 70

  Fly    62 IVKLKEVIRENDT----LYFVFEYMKENLYQMIKDRDTHLPEPELKSILFQVLTGLAFMHRHGFF 122
            ...:.|:::..:|    |..||:..:.:|:.::.||. .|....::..:..::.||.|:||..:.
 Worm    71 RRNIVEMLKSFETPEIRLGMVFKRYETDLFGILGDRQ-RLQPSTIQKYMKGLMEGLQFIHRMDYI 134

  Fly   123 HRDLKPENLLCSGPDLIKIADFG---LAREIRSRPPFTDYVSTRWYRAPEVLLHSTNYGSTIDLW 184
            |||:||||||..| :.|.|||||   |:...:...|     .|..|...|.:|.......::|:|
 Worm   135 HRDIKPENLLIDG-ETICIADFGETVLSTSDKVVKP-----GTLPYLTIEHILGYKENTKSMDIW 193

  Fly   185 AMGCIMAELYTFRPLFPGSSEVDQLFKICSVLGTPDKDDWPDGYRLASMIHFRYPDCIKVPLS-- 247
            |..|::..::....||..:|.:..:..|..:||...|:.||:..:|..|.....|     |:.  
 Worm   194 AAACVLGAMFQGSHLFSQNSNLQTIHAIRLLLGNHTKETWPEMDKLPLMQSIELP-----PVGEK 253

  Fly   248 --SVVSRCSQNGLDLLEDMLAYDPDKRPTAQQSLKYPYFHALKRISPTAATKAN 299
              |.:...::...||:|.|:.|||.||..|.|.|.:.||      ...|:.:||
 Worm   254 TFSKIENITKEAADLMEQMMKYDPTKRLMASQVLNHEYF------KKEASAQAN 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42366NP_723501.2 STKc_MAK_like 4..284 CDD:270824 84/297 (28%)
S_TKc 4..284 CDD:214567 84/297 (28%)
F52B5.2NP_492259.1 STKc_CMGC 18..292 CDD:270688 81/292 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.