DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TbCMF46 and NUD1

DIOPT Version :10

Sequence 1:NP_609325.2 Gene:TbCMF46 / 34318 FlyBaseID:FBgn0032163 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_015018.3 Gene:NUD1 / 854555 SGDID:S000005900 Length:851 Species:Saccharomyces cerevisiae


Alignment Length:274 Identity:66/274 - (24%)
Similarity:110/274 - (40%) Gaps:79/274 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 HQLE--PVVYDRITTMRLEFKNILRIDHLWMMPNLTKLCLNCNKIEVIEHLEMLTALKDLNLSFN 121
            |.||  .:.|:.:.| .|:|   |.:.|     :|.::.|:.|.|:.:|.:.. :.:|.||||.|
Yeast   543 HDLECLDLSYNLLNT-SLKF---LSLCH-----HLQEVNLSYNSIQSLEGIGS-SRMKKLNLSNN 597

  Fly   122 YITRIENLEKLV-----------KLEKLSLFSNRIRKIENIHTLQNLVILSI-GNNLIDTVEGIE 174
            .|..|.:.|:|:           .:|.|.|.:|.|..:.||:.|..|.:|:: ||.|:..||..:
Yeast   598 EINGIIDFEQLILTNNSVVGGWLTVEVLDLSNNNIIGVRNINCLPRLKVLNLNGNPLVSIVESSK 662

  Fly   175 ----RLRFVS-------------------------SLKVLNLEG-NPIAKQPDFPLSLYVIAI-- 207
                .||.:|                         :||:|.|:| ..::|...:|.:|.::.|  
Yeast   663 MENGTLRALSIKNTGGALSKLQNYKLDDQFTFPYQNLKILKLDGFAQLSKWQKWPATLQILEING 727

  Fly   208 -----LPQL------NYYEYVFIKTETREEAQKRFYRELREIEDKQEREIQGLETEAREMAEADR 261
                 ||:.      |.|....        |..|.:..|.....|:...:|.|......:..|.:
Yeast   728 GLASSLPRFSSLKSTNLYSLTI--------ANVRDFTHLPVDLSKELPFLQELHLPGNNLQNAHK 784

  Fly   262 LASSF----VEHLD 271
            |..:.    |:.||
Yeast   785 LTKTLPRQSVKFLD 798

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
TbCMF46NP_609325.2 PPP1R42 66..>190 CDD:455733 44/165 (27%)
leucine-rich repeat 69..90 CDD:275378 5/20 (25%)
leucine-rich repeat 91..112 CDD:275378 5/20 (25%)
leucine-rich repeat 113..134 CDD:275378 10/31 (32%)
leucine-rich repeat 135..156 CDD:275378 8/20 (40%)
leucine-rich repeat 157..181 CDD:275378 10/53 (19%)
SMC_prok_B 225..>530 CDD:274008 11/51 (22%)
NUD1NP_015018.3 LRR <520..802 CDD:443914 66/274 (24%)