DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TbCMF46 and dnal1

DIOPT Version :10

Sequence 1:NP_609325.2 Gene:TbCMF46 / 34318 FlyBaseID:FBgn0032163 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001003442.1 Gene:dnal1 / 445048 ZFINID:ZDB-GENE-040801-178 Length:192 Species:Danio rerio


Alignment Length:176 Identity:52/176 - (29%)
Similarity:78/176 - (44%) Gaps:49/176 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 TALKDLNLSFNYITRIE----NLEKLVKLEKLSLFSNRIRKIENIHTLQNLVILSIGNNLIDTVE 171
            ||:|    .:..|..||    :|..||..|:|||.:|.|.||.|::.|:||.|||:|.|.|..:.
Zfish    26 TAVK----LYGQIPPIEKMDASLSNLVNCERLSLSTNCIEKIANLNGLKNLKILSLGRNNIKNLN 86

  Fly   172 GIER--------------------LRFVSSLKVLNLEGNPIAKQPDFPLSLYVIAILPQLNYYEY 216
            |:|.                    :..:..||||.:..|.:.:..:|    ..:|.||.|  .:.
Zfish    87 GLEAVGDTLEELWISYNLIEKLKGIHVMKKLKVLYMSNNLVKEWGEF----LKLADLPSL--VDL 145

  Fly   217 VFIKTETR----------EEAQKRFYRELREIED----KQEREIQG 248
            ||:.....          |||.||. .:|::::.    |||.|.:|
Zfish   146 VFVGNPLEEKYSADGNWIEEATKRL-PKLKKLDGNPVIKQEEETEG 190

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
TbCMF46NP_609325.2 PPP1R42 66..>190 CDD:455733 33/102 (32%)
leucine-rich repeat 69..90 CDD:275378