DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TbCMF46 and CG14185

DIOPT Version :9

Sequence 1:NP_609325.2 Gene:TbCMF46 / 34318 FlyBaseID:FBgn0032163 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_649175.1 Gene:CG14185 / 40197 FlyBaseID:FBgn0036936 Length:402 Species:Drosophila melanogaster


Alignment Length:280 Identity:58/280 - (20%)
Similarity:99/280 - (35%) Gaps:84/280 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DAVEETEEEPLRGFLEEI------NCPEPGIID--RQMIETAYLEEGKKGEARRLHQLEPVVYDR 68
            |.....||:.|..|:..:      ..|||.:.:  |::.:...||..::...|       |:...
  Fly    76 DVAIAEEEQHLPAFVHLLPVVLPQQGPEPTLDELLRRVTQRTDLEAVEQVRLR-------VISYT 133

  Fly    69 ITTMRLEFKNILRIDHLWMMPNLTKLCLNCNKIEVIEHLEMLTALKDLNLSFNYITRI------- 126
            ::..||..          .:|.|..|.|:.:         :|::|:||......:||:       
  Fly   134 VSLSRLSL----------FLPRLQSLDLSGS---------VLSSLRDLGYGLLQLTRLDISNCGL 179

  Fly   127 ---ENLEKLVKLEKLSLFSNRIRKIENIHTLQNLVILSIGNNLIDTVEGIERLRFVSSLKVLNLE 188
               :....|..:..|....|.|::::.:..|.:|.:|...||.|..:..:..|.....|:.:.|:
  Fly   180 NSFDGTSGLPAIRVLIADGNMIQRVDPLAELVHLRVLKARNNRISELGLLSFLGMCPQLQEVELQ 244

  Fly   189 GNPIAKQPDFPLSLYVIAILPQLNYYEYVFIKTETREEAQKRFYREL--REIEDKQ---EREIQG 248
            |||:.:.|                                  .||.|  |.:...|   .|.:.|
  Fly   245 GNPVCRLP----------------------------------LYRSLLARSVPTLQLLDGRVLNG 275

  Fly   249 LETEAREMAEADRLASSFVE 268
             |....||.||...|||.:|
  Fly   276 -EPAPVEMEEATSPASSDLE 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbCMF46NP_609325.2 leucine-rich repeat 69..90 CDD:275378 2/20 (10%)
LRR_8 89..145 CDD:290566 13/65 (20%)
LRR_4 89..131 CDD:289563 10/51 (20%)
leucine-rich repeat 91..112 CDD:275378 4/20 (20%)
leucine-rich repeat 113..134 CDD:275378 6/30 (20%)
LRR_8 134..192 CDD:290566 14/57 (25%)
LRR_4 134..174 CDD:289563 9/39 (23%)
leucine-rich repeat 135..156 CDD:275378 4/20 (20%)
leucine-rich repeat 157..181 CDD:275378 6/23 (26%)
CG14185NP_649175.1 LRR_8 144..201 CDD:290566 13/65 (20%)
leucine-rich repeat 146..168 CDD:275380 7/30 (23%)
LRR_4 168..209 CDD:289563 6/40 (15%)
leucine-rich repeat 169..190 CDD:275380 3/20 (15%)
leucine-rich repeat 191..212 CDD:275380 4/20 (20%)
leucine-rich repeat 213..237 CDD:275380 6/23 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.