DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TbCMF46 and CG13708

DIOPT Version :10

Sequence 1:NP_609325.2 Gene:TbCMF46 / 34318 FlyBaseID:FBgn0032163 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_647933.1 Gene:CG13708 / 38582 FlyBaseID:FBgn0035577 Length:1301 Species:Drosophila melanogaster


Alignment Length:325 Identity:74/325 - (22%)
Similarity:127/325 - (39%) Gaps:77/325 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 IEVIEHLEMLTALKDLNLSFNYITRIENLEKLVKLEKLSLFSNRIRKIENIHTLQNLVILSIGNN 165
            |..:|.|.:..  |.|:||.:|.:..:      :|..|.|:.|:|.:|.|:..|.:|.:|.:|.|
  Fly   446 ISALEQLSIKN--KQLSLSASYGSIFQ------QLVFLDLYDNQIERIANLDGLPSLSVLLLGKN 502

  Fly   166 LIDTVEGIERLRFVSSLKVLNLEGNPIAKQPDFPLSLYVIAILPQLNYYEYVFIKTETREEAQKR 230
            .|..:.|:..|:  .:|:||:|.||   |.......:..:..|..||     ....:.|:..|:.
  Fly   503 RITDIGGLSSLK--DTLRVLDLHGN---KLTSLGSRINCLQQLKSLN-----LAGNQIRQINQQD 557

  Fly   231 F--YRELREIEDKQE--REIQGLETEAREMAEADRLASSFVEHLDGMQ----LYDSLWRDDEDGR 287
            |  .|.|||:..|:.  |.|.|.                  :||..::    .::.|.|.|:...
  Fly   558 FLGLRCLRELNLKRNKLRRINGF------------------QHLVALERLWLCHNDLHRVDDMAS 604

  Fly   288 ILMLVGAPAQEL---------------CEEYSKDVYELTQQIYRLGLERFGERDEEIRDFNANLH 337
            |     |.|..|               |..:......|.|.:.::.:      .|::|  .|.|.
  Fly   605 I-----ARATRLLEVTIENNPVSLAGDCVSFLVSYLPLLQTLSQMPI------TEQVR--RAALA 656

  Fly   338 EGQEELQAQ---GQRQIEDFLEYKERIFDEMRLKWRELDQRDDDLEQLQAQLDTLTANFEDSLNE 399
            ..|.:.|||   |..:....:. :|.:....|..|..|..:...:.:.:::|.:..|...:| ||
  Fly   657 WRQHKEQAQAAPGSSEAYHNIR-REEVISNARTNWELLRSQQTVVGRPKSRLTSELAKINES-NE 719

  Fly   400  399
              Fly   720  719

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbCMF46NP_609325.2 PPP1R42 66..>190 CDD:455733 27/88 (31%)
leucine-rich repeat 69..90 CDD:275378
leucine-rich repeat 91..112 CDD:275378 3/10 (30%)
leucine-rich repeat 113..134 CDD:275378 5/20 (25%)
leucine-rich repeat 135..156 CDD:275378 8/20 (40%)
leucine-rich repeat 157..181 CDD:275378 7/23 (30%)
SMC_prok_B 225..>530 CDD:274008 40/201 (20%)
CG13708NP_647933.1 leucine-rich repeat 449..471 CDD:275380 7/29 (24%)
PPP1R42 467..661 CDD:455733 53/240 (22%)
leucine-rich repeat 472..493 CDD:275380 8/20 (40%)
leucine-rich repeat 494..516 CDD:275380 7/23 (30%)
leucine-rich repeat 517..539 CDD:275380 7/24 (29%)
leucine-rich repeat 540..563 CDD:275380 6/27 (22%)
leucine-rich repeat 564..585 CDD:275380 9/38 (24%)
leucine-rich repeat 611..637 CDD:275380 2/25 (8%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.