DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TbCMF46 and CG8800

DIOPT Version :9

Sequence 1:NP_609325.2 Gene:TbCMF46 / 34318 FlyBaseID:FBgn0032163 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_610483.1 Gene:CG8800 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster


Alignment Length:159 Identity:53/159 - (33%)
Similarity:83/159 - (52%) Gaps:7/159 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 TAYLEEGKKGEAR-RLHQLEPVVYDRITTMRLEFKNILRIDH-LWMMPNLTKLCLNCNKIEVIEH 106
            |...|..|:.|.| :.:.|...|.|    ::.::..|.::|. |..:....::.::.|.||.|..
  Fly     5 TTIKEALKRWEEREQQNSLTAKVID----LQFQWPPIEKMDSTLGTLVQCERISMSTNMIEKIFG 65

  Fly   107 LEMLTALKDLNLSFNYITRIENLEKLVK-LEKLSLFSNRIRKIENIHTLQNLVILSIGNNLIDTV 170
            |..:..||.|:||.|||.:|..||.:.: ||:|.|..|.|.||:.:..|:.|.:|.|.||||...
  Fly    66 LSGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIEKIKGLTGLKCLKVLYISNNLIKDW 130

  Fly   171 EGIERLRFVSSLKVLNLEGNPIAKQPDFP 199
            ....||..:.||:.|.:.|||:::..|.|
  Fly   131 SEFNRLAEIESLEDLVVVGNPLSEGLDEP 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbCMF46NP_609325.2 leucine-rich repeat 69..90 CDD:275378 3/21 (14%)
LRR_8 89..145 CDD:290566 21/56 (38%)
LRR_4 89..131 CDD:289563 15/41 (37%)
leucine-rich repeat 91..112 CDD:275378 5/20 (25%)
leucine-rich repeat 113..134 CDD:275378 11/20 (55%)
LRR_8 134..192 CDD:290566 23/58 (40%)
LRR_4 134..174 CDD:289563 16/40 (40%)
leucine-rich repeat 135..156 CDD:275378 9/20 (45%)
leucine-rich repeat 157..181 CDD:275378 9/23 (39%)
CG8800NP_610483.1 PPP1R42 37..180 CDD:411060 45/123 (37%)
leucine-rich repeat 50..71 CDD:275380 5/20 (25%)
leucine-rich repeat 95..116 CDD:275380 9/20 (45%)
leucine-rich repeat 117..141 CDD:275380 9/23 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.