DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TbCMF46 and Cep97

DIOPT Version :10

Sequence 1:NP_609325.2 Gene:TbCMF46 / 34318 FlyBaseID:FBgn0032163 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_608811.2 Gene:Cep97 / 33610 FlyBaseID:FBgn0031575 Length:806 Species:Drosophila melanogaster


Alignment Length:161 Identity:48/161 - (29%)
Similarity:82/161 - (50%) Gaps:18/161 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KKGEARRLHQLEPVVYDRITTMRLEFKNILRIDHLWMMPNLTKLCLNCNKIEVIEHLEMLTALKD 115
            |:.:|..:.||           .|:...:.:||::.....:..|.|..|::..:..:..|..|::
  Fly    25 KQDDAHSIRQL-----------ILDENELQKIDNIDSYLKIETLSLARNQLLRMYGVCRLHCLRE 78

  Fly   116 LNLSFNYITRIENLEKLVKLEKLSLFSNRIRKIENIHTLQNLVILSIGNNLIDTVEGIERLRFVS 180
            ||||||.|..||.|::.:.|..|:|..|.|:.||:::|..||..|::.:|.|.::..:..||   
  Fly    79 LNLSFNGILSIEGLKECIHLRVLNLEGNNIKTIEHLNTNVNLECLNLADNSIGSISDMSYLR--- 140

  Fly   181 SLKVLNLEGNPIA--KQPD--FPLSLYVIAI 207
            :||.|.|.||.:.  :|.|  .|.||..:.:
  Fly   141 NLKELYLHGNRLTHLRQCDKCLPTSLETLTL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbCMF46NP_609325.2 PPP1R42 66..>190 CDD:455733 37/123 (30%)
leucine-rich repeat 69..90 CDD:275378 3/20 (15%)
leucine-rich repeat 91..112 CDD:275378 4/20 (20%)
leucine-rich repeat 113..134 CDD:275378 11/20 (55%)
leucine-rich repeat 135..156 CDD:275378 8/20 (40%)
leucine-rich repeat 157..181 CDD:275378 6/23 (26%)
SMC_prok_B 225..>530 CDD:274008
Cep97NP_608811.2 leucine-rich repeat 11..31 CDD:275380 2/5 (40%)
PPP1R42 13..229 CDD:455733 48/161 (30%)
leucine-rich repeat 32..53 CDD:275380 5/31 (16%)
leucine-rich repeat 76..97 CDD:275380 11/20 (55%)
leucine-rich repeat 98..119 CDD:275380 8/20 (40%)
leucine-rich repeat 120..141 CDD:275380 6/23 (26%)
leucine-rich repeat 142..165 CDD:275380 9/22 (41%)
leucine-rich repeat 166..190 CDD:275380 1/6 (17%)
IQ 581..599 CDD:197470
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.