DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TbCMF46 and dtr

DIOPT Version :9

Sequence 1:NP_609325.2 Gene:TbCMF46 / 34318 FlyBaseID:FBgn0032163 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_724335.2 Gene:dtr / 318856 FlyBaseID:FBgn0023090 Length:1483 Species:Drosophila melanogaster


Alignment Length:674 Identity:152/674 - (22%)
Similarity:243/674 - (36%) Gaps:224/674 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KKGEARRLHQLEPVVYDRITTMRLEFKNILRIDHLWMMPNLTKLCLNCNKIEVIEHLEMLTALKD 115
            ||.:..:..:|..|:|       |.::....|:.|.....|..|.|.||.|..|:.||.|:.||.
  Fly    25 KKDKLYQTPRLNDVLY-------LHYQGFQCIESLEEYTELKCLWLECNAISEIQGLEKLSKLKC 82

  Fly   116 LNLSFNYITRIENLEKLVKLEKLSLFSNRIRKIENIHT---------------------LQNLV- 158
            |.|..|.||:||||:...:|:.|:|.||.||||:||.|                     |.:|: 
  Fly    83 LFLQNNLITKIENLDPCRELDTLNLSSNHIRKIQNIGTNVLPVLNTLTISSNYLKDSESLSDLIQ 147

  Fly   159 -----ILSIGNNLIDTVEGIERLRFVSSLKVLNLEGNP-IAKQPDFPLSLYVIAILPQLNYYEY- 216
                 :|.:.||.||.:..::....:.:||||.|:||| :::.|.:..:|  |....:|.|.:. 
  Fly   148 CKTLSVLDLSNNRIDDILIVKIFEQMLNLKVLVLQGNPVVSRLPQYRKTL--ILACKELTYLDSR 210

  Fly   217 -VFIKTETREEAQKR----------------FYRELREI-------------EDKQEREIQGLET 251
             ||.:.....||.||                ..|:.||.             .|:|:..::..::
  Fly   211 PVFPRDRACAEAWKRDGYEGERKENNRWNRAERRKTRESINCTIRMRNSHRPPDQQDPLLRSSDS 275

  Fly   252 EAREMAEADRL----------------------------ASSFVEHLDGMQLYDSLW------RD 282
            |....||..|.                            :||.:|..||....|.|.      |.
  Fly   276 EDDTCAETARKKVALENGCVDDLWEEVSGEQPISEDGTNSSSSLEDNDGTSSQDDLIAEKLSNRR 340

  Fly   283 DEDGRILML---------------------VGAPAQELCEEYSKDVYEL-------------TQQ 313
            ..:||..:|                     ||..:|.:.|:  |.|.::             ...
  Fly   341 TLEGRPTVLYETEVSNVKSANNDINIFEEGVGKASQIIIED--KPVTKIKLINEPSCMNDKSAMN 403

  Fly   314 IYRLG---LERFGERDEEIRDFN-----ANLHEGQEELQAQ---GQRQIEDF----------LEY 357
            ...:|   .|...:.|.||::.:     .||.:..|::.::   ..:..:||          .|.
  Fly   404 CTSMGPVVKENDFDEDAEIKNVDDMVPCQNLIKSNEDINSEFGFSSKLKQDFDQTCTALRNDAEC 468

  Fly   358 KERIFDEMRLKWRELDQRDDDLEQLQAQLDTLTANFEDSLNELWESLMAQELHLHEA-----VED 417
            ||  |||      ||..::.:.:......|...|. :|.|||      ..:|:|:|.     |.|
  Fly   469 KE--FDE------ELTIKESESKPFNEMYDIFAAE-DDKLNE------TLDLNLNETTCPHHVHD 518

  Fly   418 STLKFNRKI-----SDLMSNFVEQAQVIFLQLRD------LCSYFADNM-----TDIVNQFLST- 465
            :......|:     .|:|.|.:.:.:...|..:|      .|::..|.|     .|:.....|| 
  Fly   519 NFFSEQNKMPSFYEEDIMINLLPKTKEKTLLEKDSIIENEKCAHDLDEMGRQMEEDLAELRQSTQ 583

  Fly   466 --------KLARNELNTIPEE-----------LKQCVDDREAVLQLVEGMRTTHTSRVDK----- 506
                    :.||.:..|..|:           |||...||...:.|.|..:....|..|:     
  Fly   584 NLIGISIDETARTDSETDEEDLIAQQDPYSPLLKQQFKDRRMKIMLTEETKAQEESLSDRNIALS 648

  Fly   507 ----REDRLAQRSRQFIDDMITNL 526
                ::|:..|...:.:||...|:
  Fly   649 NESDQDDKQDQLFAKILDDATENI 672

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbCMF46NP_609325.2 leucine-rich repeat 69..90 CDD:275378 3/20 (15%)
LRR_8 89..145 CDD:290566 26/55 (47%)
LRR_4 89..131 CDD:289563 21/41 (51%)
leucine-rich repeat 91..112 CDD:275378 10/20 (50%)
leucine-rich repeat 113..134 CDD:275378 11/20 (55%)
LRR_8 134..192 CDD:290566 27/85 (32%)
LRR_4 134..174 CDD:289563 19/66 (29%)
leucine-rich repeat 135..156 CDD:275378 13/41 (32%)
leucine-rich repeat 157..181 CDD:275378 6/29 (21%)
dtrNP_724335.2 leucine-rich repeat 38..57 CDD:275380 5/25 (20%)
LRR_8 56..112 CDD:290566 26/55 (47%)
LRR_4 56..98 CDD:289563 21/41 (51%)
LRR_RI 58..>184 CDD:238064 45/125 (36%)
leucine-rich repeat 58..79 CDD:275380 10/20 (50%)
leucine-rich repeat 80..101 CDD:275380 11/20 (55%)
LRR_8 100..161 CDD:290566 17/60 (28%)
leucine-rich repeat 102..125 CDD:275380 12/22 (55%)
leucine-rich repeat 126..147 CDD:275380 2/20 (10%)
leucine-rich repeat 151..175 CDD:275380 5/23 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447147
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45973
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.