DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4594 and CG14787

DIOPT Version :10

Sequence 1:NP_609323.1 Gene:CG4594 / 34316 FlyBaseID:FBgn0032161 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_569914.2 Gene:CG14787 / 31096 FlyBaseID:FBgn0027793 Length:260 Species:Drosophila melanogaster


Alignment Length:105 Identity:28/105 - (26%)
Similarity:48/105 - (45%) Gaps:21/105 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 RMFTTQEAFEVGLIDEIASSKEEALEKCAAFIGTFA-----KVNPLA--RGLTKLQFR------- 236
            |.:..:..:|:....::||:  :|..|.....|.|:     ::.|||  :||.....|       
  Fly    28 RRWQRRTLYELMRALDLASA--DAAVKVVVLSGEFSAACGGEMEPLALKQGLENRSRRTASHEEA 90

  Fly   237 -GDNIKEFEMIREKDIADFV--ALASSPGV-QKVMGAYLE 272
             |....|.:.|.|| .|:||  :||....| :|::.|::|
  Fly    91 VGSGDAEEQYIHEK-AANFVMRSLAKKLLVHRKLLVAFVE 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4594NP_609323.1 crotonase-like 35..280 CDD:474030 28/105 (27%)
CG14787NP_569914.2 crotonase-like 13..216 CDD:474030 28/105 (27%)

Return to query results.
Submit another query.