DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4594 and Cdyl2

DIOPT Version :10

Sequence 1:NP_609323.1 Gene:CG4594 / 34316 FlyBaseID:FBgn0032161 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_017456726.1 Gene:Cdyl2 / 292044 RGDID:1309548 Length:551 Species:Rattus norvegicus


Alignment Length:258 Identity:57/258 - (22%)
Similarity:101/258 - (39%) Gaps:60/258 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 NSQNVQLLLDLQTSISEIENNKSRGLILTSASSNVFSAGLDIFEMYNTDVERLRT--------VW 103
            |:...:::.:::.::.....:.|: |:|.||..:||.:|||    |:..:.||.:        :.
  Rat   318 NALTPEIMKEVRRALCNAATDDSK-LLLLSAVGSVFCSGLD----YSYLIGRLSSDRRKESTRIA 377

  Fly   104 TELQNVWIALYGTTLPTAAAINGHAPAGGCLLATACE-------------YRVMRPNFLIGLNEA 155
            ..:::...|......|...||||.|...|..:...|:             |..:|          
  Rat   378 EAIRDFVKAFIQFKKPIVVAINGPALGLGASILPLCDIVWASEKAWFQTPYATIR---------- 432

  Fly   156 QLGIIAPKWLMS-GFASILPKRVAERALTQGRMFTTQEAFEVGLIDEI----ASSKE-----EAL 210
                :.|....| .|..||...:|...|..||..|.|||...||:.::    ..|:|     :.:
  Rat   433 ----LTPAGCSSYTFPQILGVALANEMLFCGRKLTAQEACSRGLVSQVFWPTTFSQEVMLRVKEM 493

  Fly   211 EKCAAFIGTFAKVNPLARGLTKLQFRGDNIKEFEMIREKDIADFVALASSPGVQKVMGAYLEN 273
            ..|:|.:...:|.  |.|...|......|.||..|:::       ..:||.|:..:. :||::
  Rat   494 ASCSAVVLEDSKC--LVRSFLKSVLEDVNEKECLMLKQ-------LWSSSKGLDSLF-SYLQD 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4594NP_609323.1 crotonase-like 35..280 CDD:474030 57/258 (22%)
Cdyl2XP_017456726.1 CD_CDY 57..105 CDD:349284
crotonase-like 297..493 CDD:119339 42/193 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.