DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and Hadha

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_849209.1 Gene:Hadha / 97212 MGIID:2135593 Length:763 Species:Mus musculus


Alignment Length:316 Identity:79/316 - (25%)
Similarity:138/316 - (43%) Gaps:58/316 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMRSKVLSLVARAGSNRMM-----------STATKLTTVEVN--DKTGIATLTMNRP--PVNGLN 50
            |:.|:.:..::|..:.|::           :::..||...:|  .|..:|.:.:|.|  .||.||
Mouse     1 MVASRAIGSLSRFSAFRILRSRGCICRSFTTSSALLTRTHINYGVKGDVAVIRINSPNSKVNTLN 65

  Fly    51 LELLQDLKSSIDEIESN-KSRGLILTSSSSTIFSAGLDILEMYKPDKDRIRAFWTQLQDTWLALY 114
            .|:..:....::||.:| :.|..:|.||....|.||.||        :.:.:..|..:.|.::..
Mouse    66 KEVQSEFIEVMNEIWANDQIRSAVLISSKPGCFVAGADI--------NMLSSCTTPQEATRISQE 122

  Fly   115 G---------SSVPTAAAINGHSPAGGCLLATSCEYRVMVPN--FTIGLNETQLGIVAPQWFMAS 168
            |         |..|..|||:|....||..||.:|:||:...:  ..:|:.|..|||:..    |.
Mouse   123 GQRMFEKLEKSPKPVVAAISGSCLGGGLELAIACQYRIATKDRKTVLGVPEVLLGILPG----AG 183

  Fly   169 FLSVLPQRIAERA----LNQGRMFTTEEALKVGLIDETANNKEEAI----EKCVAFIGTFAKVNP 225
            ....||:.:...|    :..||....:.|.|:||:|:........|    |:.:.::...| || 
Mouse   184 GTQRLPKMVGVPAAFDMMLTGRNIRADRAKKMGLVDQLVEPLGPGIKSPEERTIEYLEEVA-VN- 246

  Fly   226 LARSLTKQQFRAADLQQLQNGRKEDLEKFLFFVNQPAVQKGLGIYLEGLKKKAKKQ 281
            .|:.|..::..|    :...|..|.|..:...|  |.|::  .:| :.:::|.|||
Mouse   247 FAKGLADRKVSA----KQSKGLVEKLTTYAMTV--PFVRQ--QVY-KTVEEKVKKQ 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 56/213 (26%)
HadhaNP_849209.1 fa_ox_alpha_mit 27..762 CDD:131494 75/290 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.