DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and Echs1

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_444349.1 Gene:Echs1 / 93747 MGIID:2136460 Length:290 Species:Mus musculus


Alignment Length:291 Identity:73/291 - (25%)
Similarity:124/291 - (42%) Gaps:34/291 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SKVLSLVARAGSNRMMSTAT--KLTTVEVNDKTGIATLTMNRP-PVNGLNLELLQDLKSSIDEIE 65
            |.:||.|......|..|.|.  .:.|.:....:.:..:.:||| .:|.|...|:::|..:::..|
Mouse    13 SSLLSSVRCPELRRFASGANFQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFE 77

  Fly    66 SNKSRGLILTSSSSTIFSAGLDILEMYKPDKDRIRAFWTQLQDTWLALYGS--------SVPTAA 122
            .:.:.|.|:.:.....|:||.||.||..      |.|    ||.:.:.:.|        ..|..|
Mouse    78 QDPAVGAIVLTGGDKAFAAGADIKEMQN------RTF----QDCYSSKFLSHWDHITRVKKPVIA 132

  Fly   123 AINGHSPAGGCLLATSCEYRVMVPNFTIGLNETQLGIVAPQWFMASFLSVLPQRIAERALNQGRM 187
            |:||::..|||.||..|:..........|..|..||.:............:.:.:|...:..|..
Mouse   133 AVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDR 197

  Fly   188 FTTEEALKVGLIDE---TANNKEEAIEKCVAFIGTFAKVNPLARSLTKQQFRAADLQQLQNGRKE 249
            .:.::|.:.||:.:   .....||||: |...|.:.:|:   ..::.|:...||....|..|.| 
Mouse   198 ISAQDAKQAGLVSKIFPVEKLVEEAIQ-CAEKIASNSKI---VVAMAKESVNAAFEMTLTEGNK- 257

  Fly   250 DLEKFLFFVN--QPAVQKGLGIYLEGLKKKA 278
             |||.||:..  ....::|:..::|  |:||
Mouse   258 -LEKRLFYSTFATDDRREGMTAFVE--KRKA 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 48/201 (24%)
Echs1NP_444349.1 crotonase-like 32..288 CDD:304874 66/272 (24%)
PRK05617 36..288 CDD:235533 66/268 (25%)
Substrate binding. /evidence=ECO:0000250 98..101 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.