DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and DCI1

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_014823.3 Gene:DCI1 / 854352 SGDID:S000005706 Length:271 Species:Saccharomyces cerevisiae


Alignment Length:238 Identity:50/238 - (21%)
Similarity:79/238 - (33%) Gaps:74/238 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VNGLNLELLQDLKSSIDEIESNKSRGLILTSSSSTIFSAGLDILEMYKPDKDRIRAFWTQLQDTW 110
            ||.||   ..|:.|.::::..     |:...||..||.|               .||....:...
Yeast    69 VNKLN---DGDVTSEVEKVSK-----LVSAISSPNIFVA---------------NAFAIHKKVLV 110

  Fly   111 LALYGSSVPTAAAINGHSPAGGCLLATSCEYRVMVPNFTIGL--NETQLGIVAPQWFMASFLSVL 173
            ..|.|.::..:|:           |...|:. |...|.::.|  ..:.||.||.    ......|
Yeast   111 CCLNGPAIGLSAS-----------LVALCDI-VYSQNDSVFLLFPFSNLGFVAE----VGTSVTL 159

  Fly   174 PQRIAERALNQGRMFTTEEALK--VGLI---DETANNKEEAIEKCVAFI-----GTFAK----VN 224
            .|::...:.|:..:|:|....|  :|.|   :....|.|...||.:..|     |.:.|    :.
Yeast   160 TQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETFNEKVLQDIKQNLEGLYPKSVLGMK 224

  Fly   225 PLARSLTKQQFRAAD-------------------LQQLQNGRK 248
            .|..|..||:...|.                   .:|||.|.:
Yeast   225 ELLHSEMKQKLIKAQAMETNGTLPFWASGEPFKRFKQLQEGNR 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 38/177 (21%)
DCI1NP_014823.3 CaiD 1..264 CDD:223955 48/233 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.