DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and EHD3

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_010321.1 Gene:EHD3 / 851606 SGDID:S000002443 Length:500 Species:Saccharomyces cerevisiae


Alignment Length:302 Identity:62/302 - (20%)
Similarity:119/302 - (39%) Gaps:53/302 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMRS--KVLSLVARAG----SNRMMSTATKLTTVE-------VNDKTGIATLTMNRP-PVNGLNL 51
            |:|:  |...|.::.|    :...|:|..:|...:       |.|...:  :|:||| .:|.||.
Yeast     1 MLRNTLKCAQLSSKYGFKTTTRTFMTTQPQLNVTDAPPVLFTVQDTARV--ITLNRPKKLNALNA 63

  Fly    52 ELLQDLKSSIDEIESNKSRGLILTSSSS--TIFSAGLDI--LEMYKPDKDRIRA--FWTQLQDTW 110
            |:.:.:..:::|...:.:..|::..||:  ..|.||.|:  :.::..:|:..::  |:|......
Yeast    64 EMSESMFKTLNEYAKSDTTNLVILKSSNRPRSFCAGGDVATVAIFNFNKEFAKSIKFFTDEYSLN 128

  Fly   111 LALYGSSVPTAAAINGHSPAGGCLLATSCEYRVMVPNFTIGLNETQLGIV--APQWFMASFLSVL 173
            ..:.....|....::|.:..||..|:....:|:...|....:.|..:|..  ....|....:..|
Yeast   129 FQIATYLKPIVTFMDGITMGGGVGLSIHTPFRIATENTKWAMPEMDIGFFPDVGSTFALPRIVTL 193

  Fly   174 PQRIAERALN---QGRMFTTEEALKVGLIDETANNKE-EAIEKCVAFIGT-----------FAKV 223
            ....::.||.   .|.:.|..:|..:||.....:::. :|::|.:..|..           |..|
Yeast   194 ANSNSQMALYLCLTGEVVTGADAYMLGLASHYVSSENLDALQKRLGEISPPFNNDPQSAYFFGMV 258

  Fly   224 N--------PLAR------SLTKQQFRAADLQQLQNGRKEDL 251
            |        ||.:      |..|.....|.....:||..||:
Yeast   259 NESIDEFVSPLPKDYVFKYSNEKLNVIEACFNLSKNGTIEDI 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 41/209 (20%)
EHD3NP_010321.1 ECH_2 48..386 CDD:406503 52/255 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.