DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and ECI1

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_176730.1 Gene:ECI1 / 842864 AraportID:AT1G65520 Length:240 Species:Arabidopsis thaliana


Alignment Length:200 Identity:56/200 - (28%)
Similarity:100/200 - (50%) Gaps:19/200 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LTTVEVNDKTGIATLTMNRPPVNGLNLELLQDLKSSIDEIESNK--SRGLILTSSSSTIFSAGLD 87
            :.::|..|:..|..||.:..  :.||..||..|:|:|::|.|:.  |:.:::|:|....||.|.|
plant     1 MCSLEKRDRLFILKLTGDGE--HRLNPTLLDSLRSTINQIRSDPSFSQSVLITTSDGKFFSNGYD 63

  Fly    88 I-LEMYKPDKDRIRAFWTQLQDTWLALYGSSVPTAAAINGHSPAGGCLLATSCEYRVMVPN--FT 149
            : |....|....:..  .:|:.....|....:||.||:.||:.|.||:||.|.:|.:|..:  | 
plant    64 LALAESNPSLSVVMD--AKLRSLVADLISLPMPTIAAVTGHASAAGCILAMSHDYVLMRRDRGF- 125

  Fly   150 IGLNETQLGIVAPQWFMASFLSVLPQRIAERALNQGRMF-----TTEEALKVGLIDETANNKEEA 209
            :.::|..:.::.|.||||    |:..:|...|..:..|.     |.:..:|:|::|....:..|.
plant   126 LYMSELDIELIVPAWFMA----VIRGKIGSPAARRDVMLTAAKVTADVGVKMGIVDSAYGSAAET 186

  Fly   210 IEKCV 214
            :|..:
plant   187 VEAAI 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 56/197 (28%)
ECI1NP_176730.1 PLN02267 1..240 CDD:215151 56/199 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D974911at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.