DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and ECHID

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_176255.2 Gene:ECHID / 842350 AraportID:AT1G60550 Length:337 Species:Arabidopsis thaliana


Alignment Length:231 Identity:54/231 - (23%)
Similarity:90/231 - (38%) Gaps:50/231 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GIATLTMNRPP-VNGLNLELLQDLKSSIDEIESNKSRG-LILTSSSSTIFSAG----LDILEMYK 93
            |||.:|:|||. .|....:.:::|..:.::...:.|.| :|||...:..|.:|    |...:.|.
plant    86 GIAKITINRPERRNAFRPQTVKELMRAFNDARDDSSVGVIILTGKGTKAFCSGGDQALRTQDGYA 150

  Fly    94 PDKD--RIRAFWTQLQDTWLALYGSSVPTAAAINGHSPAGGCLLATSCEYRVMVPNFTIGLNETQ 156
            ...|  |:.....|:|...|     ..|..|.:.|::..||.:|...|:..:...|...|....:
plant   151 DPNDVGRLNVLDLQVQIRRL-----PKPVIAMVAGYAVGGGHILHMVCDLTIAADNAIFGQTGPK 210

  Fly   157 LG-------------IVAPQ-----WFMASFLSVLPQRIAERALNQGRMFTTEEALKVGLIDETA 203
            :|             :|.|:     |||.                  |.:|..||.|:|||: |.
plant   211 VGSFDAGYGSSIMSRLVGPKKAREMWFMT------------------RFYTASEAEKMGLIN-TV 256

  Fly   204 NNKEEAIEKCVAFIGTFAKVNPLARSLTKQQFRAAD 239
            ...|:..::.|.:.....:.:|.|..:.|....|.|
plant   257 VPLEDLEKETVKWCREILRNSPTAIRVLKAALNAVD 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 49/207 (24%)
ECHIDNP_176255.2 PLN02921 7..337 CDD:178509 54/231 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.