DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and hibch

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001014338.1 Gene:hibch / 798364 ZFINID:ZDB-GENE-050327-29 Length:382 Species:Danio rerio


Alignment Length:348 Identity:75/348 - (21%)
Similarity:133/348 - (38%) Gaps:90/348 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RSKVLSLVARAGSNRMMSTATKLTTVEVNDKTGIATLTMNRP-PVNGLNLELLQDLKSSIDEIES 66
            |.:.:..:.|...:.|.|.|......|...|.|:  :|:||| .:|.|.|.:::.:...:.:.:.
Zfish    11 RLRSVCRLQRIHGHMMSSKAGSEVLFEKVGKAGV--ITLNRPKALNALTLNMIRHIYPQLKKWDK 73

  Fly    67 NKSRGL-ILTSSSSTIFSAGLD---ILEMYKPDKDRIRAFWTQ---LQDTWLALYGSSVPTAAAI 124
            :....: |:..:....|.||.|   |.|..|......:.|:.:   |.:| :..|  ..|..|.|
Zfish    74 DSETDIVIIKGAGEKAFCAGGDIRAIAEAGKAGNLLSQVFFREEYILNNT-IGTY--QKPYVALI 135

  Fly   125 NGHSPAGGCLLATSCEYRVMVPNFTIGLNETQLGI---VAPQWF-------MASFLSVLPQRIAE 179
            ||.:..||..|:...::||........:.||.:|:   |...:|       :..||::...|:..
Zfish   136 NGITMGGGVGLSVHGQFRVATEKTLFAMPETGIGLFPDVGGGYFLPRLQGKLGLFLALTGFRLKG 200

  Fly   180 RALNQGRMFT----TE--EALKVGLID-------------------------------------- 200
            |.:.:..:.|    :|  |:|:..|:|                                      
Zfish   201 RDVQRVGVATHFVQSEKIESLEKDLVDLKSPSISDVAQLLDSYQEQSHLDAEKPFVLQEQTEAID 265

  Fly   201 --ETANNKEEAIEKC----VAF----IGTFAKVNPLARSLTKQQFRAADLQQLQNGRKEDLEKFL 255
              .:|.:.||.:|..    .||    ..|.||::|.:..||   ||     |::.|.:..|:: :
Zfish   266 RLFSAGSVEEIVENLKKDGSAFALKQAETLAKMSPTSLKLT---FR-----QIEEGARMSLQE-V 321

  Fly   256 FFVN---QPAVQKGLGIYLEGLK 275
            |.:.   ..|...|...| ||::
Zfish   322 FMMEYRLSQACMNGHDFY-EGVR 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 53/261 (20%)
hibchNP_001014338.1 PRK05617 30..374 CDD:235533 71/329 (22%)
ECH_2 43..371 CDD:292731 68/316 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.