| Sequence 1: | NP_001260304.1 | Gene: | CG4598 / 34315 | FlyBaseID: | FBgn0032160 | Length: | 281 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_076226.2 | Gene: | Ehhadh / 74147 | MGIID: | 1277964 | Length: | 718 | Species: | Mus musculus |
| Alignment Length: | 196 | Identity: | 52/196 - (26%) |
|---|---|---|---|
| Similarity: | 87/196 - (44%) | Gaps: | 33/196 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 36 IATLTMNRPPVNGLNLELLQDLKSSIDEIESNKSRGLILTSSSSTIFSAGLDILEMYKPDKDRIR 100
Fly 101 AFWTQLQDTWLALYGSSV--------PTAAAINGHSPAGGCLLATSCEYRVMVPNFTIGLNETQL 157
Fly 158 GIVAPQWFMASFLSVLPQ----RIAERALNQGRMFTTEEALKVGLIDETANNKEEAIEKCVAFIG 218
Fly 219 T 219 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4598 | NP_001260304.1 | crotonase-like | 27..217 | CDD:119339 | 50/192 (26%) |
| Ehhadh | NP_076226.2 | Enoyl-CoA hydratase / isomerase | 1..280 | 52/196 (27%) | |
| crotonase-like | 12..186 | CDD:119339 | 52/195 (27%) | ||
| fadJ | 20..702 | CDD:236864 | 50/187 (27%) | ||
| 3-hydroxyacyl-CoA dehydrogenase | 281..567 | ||||
| 3HCDH_N | 297..471 | CDD:280833 | |||
| 3HCDH | 473..577 | CDD:279114 | |||
| 3HCDH | 614..700 | CDD:279114 | |||
| Microbody targeting signal. /evidence=ECO:0000250 | 716..718 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG1024 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||