DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and ECHDC1

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001132982.1 Gene:ECHDC1 / 55862 HGNCID:21489 Length:307 Species:Homo sapiens


Alignment Length:266 Identity:63/266 - (23%)
Similarity:122/266 - (45%) Gaps:39/266 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DKTGIATLTMNRPP-VNGLNLELLQDLKSSIDEIES-NKSRGLILTSSSSTIFSAGLDILEMYKP 94
            :..||..||:|.|. :|..:..::..|...:.|:|: .:.:|||:..:.:| ||:|.|:      
Human    60 EDNGIGILTLNNPSRMNAFSGVMMLQLLEKVIELENWTEGKGLIVRGAKNT-FSSGSDL------ 117

  Fly    95 DKDRIRAFWTQ---------LQDTWLALYGSSVPTAAAINGHSPAGGCLLATSCEYRVMVPNFTI 150
              :.:::..|.         :|:|........:.:.|.:.|.:..||....|:|::|:|.|...|
Human   118 --NAVKSLGTPEDGMAVCMFMQNTLTRFMRLPLISVALVQGWALGGGAEFTTACDFRLMTPESKI 180

  Fly   151 GLNETQLGIVAPQW-FMASFLSVLPQRIAERALNQGRMFTTEEALKVGLIDETANNKEE--AIEK 212
            .....::||: |.| .....:.::..|.|.:.|:......::.||.:|:::|...:.:|  ::|:
Human   181 RFVHKEMGII-PSWGGTTRLVEIIGSRQALKVLSGALKLDSKNALNIGMVEEVLQSSDETKSLEE 244

  Fly   213 CVAFIGTFAKVNP-LARSLTKQQFRAADL---QQLQNGRKEDLEKFLFFVNQPAVQKGLGIYLEG 273
            ...::..|.:..| :.|:|.|......:|   :.|||.|  ||...::  ..||       .||.
Human   245 AQEWLKQFIQGPPEVIRALKKSVCSGRELYLEEALQNER--DLLGTVW--GGPA-------NLEA 298

  Fly   274 LKKKAK 279
            :.||.|
Human   299 IAKKGK 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 44/198 (22%)
ECHDC1NP_001132982.1 crotonase-like 60..251 CDD:119339 44/200 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.