DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and hadhaa

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001098746.1 Gene:hadhaa / 553401 ZFINID:ZDB-GENE-031222-5 Length:761 Species:Danio rerio


Alignment Length:280 Identity:68/280 - (24%)
Similarity:109/280 - (38%) Gaps:71/280 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RMMSTATKL---TTVEVNDKTGIATLTMNRP--PVNGLNLELLQDLKSSIDEIESNKS-RGLILT 75
            |.:|.::.:   |.|....|..:|.:.:|.|  .||.|:..:..::...::|:..|.| :..:|.
Zfish    25 RSLSVSSAVLARTHVSYEVKDNVAVVRINDPTSKVNTLSKHMQAEMVEVMNEVWGNSSVKSAVLI 89

  Fly    76 SSSSTIFSAGLDILEMYKPDKDRIRAFWTQLQDTWLALYG---------SSVPTAAAINGHSPAG 131
            |.....|.||.||        :.|:|..|..:.|.|:..|         |.:|..|||||....|
Zfish    90 SRKPGCFIAGADI--------NMIQACTTAEEVTSLSQAGQKMFEQIEKSPIPIVAAINGSCLGG 146

  Fly   132 GCLLATSCEYRVMVPN--FTIGLNETQLGIVAPQWFMASFLSVLPQRIAERA----LNQGRMFTT 190
            |...|.:|:||:...:  ..:|..|..||::..    |.....||:.:...|    :..||....
Zfish   147 GLEFAIACQYRIATKSKKTVLGTPEVMLGLLPG----AGGTQRLPKMVGLPAAFDMMLTGRNIRA 207

  Fly   191 EEALKVGLIDETANNKEEAIEKCVAFIGTFAKVNPLARSLTKQQFR--------AADLQQLQNGR 247
            ::|.|:||:.:.                    |:||...|...:.|        |.|..:....:
Zfish   208 DKAKKMGLVHQL--------------------VDPLGPGLKSPEERTIEYLEEVAVDFAKGLAAK 252

  Fly   248 KEDLEKFLFFVNQPAVQKGL 267
            |..|||          :|||
Zfish   253 KVTLEK----------KKGL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 51/207 (25%)
hadhaaNP_001098746.1 fa_ox_alpha_mit 25..760 CDD:131494 68/280 (24%)
crotonase-like 39..249 CDD:119339 58/241 (24%)
3HCDH_N 361..539 CDD:280833
3HCDH 542..637 CDD:279114
3HCDH 674..>750 CDD:279114
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.