DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and ECHDC2

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_011540011.1 Gene:ECHDC2 / 55268 HGNCID:23408 Length:318 Species:Homo sapiens


Alignment Length:203 Identity:53/203 - (26%)
Similarity:89/203 - (43%) Gaps:5/203 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GIATLTMNRPPV-NGLNLELLQDLKSSIDEI-ESNKSRGLILTSSSSTIFSAGLDILEMYKPDKD 97
            ||..:.||||.. |.|....:.:|..::.:: |..:.|.|:..|....:|.||.|:.|..:..:.
Human    41 GITEILMNRPSARNALGNVFVSELLETLAQLREDRQVRVLLFRSGVKGVFCAGADLKEREQMSEA 105

  Fly    98 RIRAFWTQLQDTWLALYGSSVPTAAAINGHSPAGGCLLATSCEYRVMVPNFTIGLNETQLGIVAP 162
            .:..|..:|:.....:.....||.||::|.:..||..||.:|:.||...:..:||.||..|::..
Human   106 EVGVFVQRLRGLMNDIAAFPAPTIAAMDGFALGGGLELALACDLRVAASSAVMGLIETTRGLLPG 170

  Fly   163 QWFMASFLSVLPQRIAERALNQGRMFTTEEALKVGLIDETANNKEE---AIEKCVAFIGTFAKVN 224
            ..........|...:|:..:..||..:..||..:||::......||   |.::..|.........
Human   171 AGGTQRLPRCLGVALAKELIFTGRRLSGTEAHVLGLVNHAVAQNEEGDAAYQRARALAQEILPQA 235

  Fly   225 PLARSLTK 232
            |:|..|.|
Human   236 PIAVRLGK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 49/186 (26%)
ECHDC2XP_011540011.1 crotonase-like 38..252 CDD:304874 53/203 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.