Sequence 1: | NP_001260304.1 | Gene: | CG4598 / 34315 | FlyBaseID: | FBgn0032160 | Length: | 281 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011540011.1 | Gene: | ECHDC2 / 55268 | HGNCID: | 23408 | Length: | 318 | Species: | Homo sapiens |
Alignment Length: | 203 | Identity: | 53/203 - (26%) |
---|---|---|---|
Similarity: | 89/203 - (43%) | Gaps: | 5/203 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 GIATLTMNRPPV-NGLNLELLQDLKSSIDEI-ESNKSRGLILTSSSSTIFSAGLDILEMYKPDKD 97
Fly 98 RIRAFWTQLQDTWLALYGSSVPTAAAINGHSPAGGCLLATSCEYRVMVPNFTIGLNETQLGIVAP 162
Fly 163 QWFMASFLSVLPQRIAERALNQGRMFTTEEALKVGLIDETANNKEE---AIEKCVAFIGTFAKVN 224
Fly 225 PLARSLTK 232 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4598 | NP_001260304.1 | crotonase-like | 27..217 | CDD:119339 | 49/186 (26%) |
ECHDC2 | XP_011540011.1 | crotonase-like | 38..252 | CDD:304874 | 53/203 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1024 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |