DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and Echdc1

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_006512860.1 Gene:Echdc1 / 52665 MGIID:1277169 Length:374 Species:Mus musculus


Alignment Length:265 Identity:70/265 - (26%)
Similarity:121/265 - (45%) Gaps:39/265 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KTGIATLTMNRP-PVNGLNLELLQDLKSSIDEIES-NKSRGLILTSSSSTIFSAGLDILEMYKPD 95
            :.||..||:|.| .:|..:..::..|...:.|:|: .:.:|||:..:.:| |.:|.|:       
Mouse   128 QNGIGILTLNNPNKMNAFSGVMMLQLLERVIELENWTEGKGLIIHGAKNT-FCSGSDL------- 184

  Fly    96 KDRIRAFWTQLQDTWLALYGSSVPT---------AAAINGHSPAGGCLLATSCEYRVMVPNFTIG 151
             :.::|..|......|:::..:..|         .|.:.|.:..||..|.|:|::|:|.....|.
Mouse   185 -NAVKALSTPESGVALSMFMQNTLTRFMRLPLISVALVQGWAMGGGAELTTACDFRLMTEESVIR 248

  Fly   152 LNETQLGIVAPQWFMAS-FLSVLPQRIAERALNQGRMFTTEEALKVGLIDETANNKEE--AIEKC 213
            ....::||| |.|...| .:.::..|.|.:.|:......::|||.:||.||.....:|  |:|:.
Mouse   249 FVHKEMGIV-PSWGGTSRLVEIIGSRQALKVLSGTLKLDSKEALNIGLTDEVLQPSDETTALEQA 312

  Fly   214 VAFIGTFAKVNP-LARSLTKQQFRAADL---QQLQNGRKEDLEKFLFFVNQPAVQKGLGIYLEGL 274
            ..::..|....| :.|.|.|....|.:|   :.|||.|  |:.:.|:  ..||       .||.:
Mouse   313 QEWLEKFVSGPPQVIRGLKKSVCSARELYIEEALQNER--DVLETLW--GGPA-------NLEAI 366

  Fly   275 KKKAK 279
            .||.|
Mouse   367 AKKGK 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 50/197 (25%)
Echdc1XP_006512860.1 crotonase-like 124..318 CDD:119339 50/199 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.