DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and Echdc2

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_081004.2 Gene:Echdc2 / 52430 MGIID:1289238 Length:296 Species:Mus musculus


Alignment Length:288 Identity:70/288 - (24%)
Similarity:121/288 - (42%) Gaps:33/288 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AGSNRMMSTATKLT-TVEVNDKT----GIATLTMNRPPV-NGLNLELLQDLKSSIDEI-ESNKSR 70
            :|:....|.||..| .::|...|    ||..:.||||.. |.|....:.:|..::.:: |..:.|
Mouse    18 SGARDCASHATTRTPEIQVQALTGPNQGITEILMNRPNARNALGNVFVSELLEALAQLREDQQVR 82

  Fly    71 GLILTSSSSTIFSAGLDILEMYKPDKDRIRAFWTQLQDTWLALYGSSVPTAAAINGHSPAGGCLL 135
            .|:..|:...:|.||.|:.|..:.....:..|..:|:.....:....|||.||::|.:..||..|
Mouse    83 VLLFRSAVKGVFCAGADLKEREQMSDVEVGTFVQRLRGLMSEIAAFPVPTIAAMDGFALGGGLEL 147

  Fly   136 ATSCEYRVMVPNFTIGLNETQLGIVAPQWFMASFLSVLPQRIAERALNQGRMFTTEEALKVGLID 200
            |.:|:.|:...:..:||.||..|::............|...:|:..:..||.....:|.::||::
Mouse   148 ALACDLRIAASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELIFTGRRLNGAQARELGLVN 212

  Fly   201 ETANNKEE---AIEKCVAFIGTFAKVNPLARSLTKQQFRAADLQQLQNGRKED------LEKFLF 256
            ......||   |..:.:|.........|:|..|.|        ..:..|.:.|      :|:..:
Mouse   213 HAVAQNEEGNAAYHRALALAQEILPQAPIAVRLGK--------VAIDRGMEVDIASGMAIEQMCY 269

  Fly   257 FVNQPAVQKGLGIYLEGL----KKKAKK 280
            ..|.|...:     |||:    :|:|.|
Mouse   270 AQNIPTQDR-----LEGMAAFREKRAPK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 50/198 (25%)
Echdc2NP_081004.2 crotonase-like 42..296 CDD:304874 63/264 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.