DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and zgc:101569

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001005995.2 Gene:zgc:101569 / 449822 ZFINID:ZDB-GENE-041010-72 Length:309 Species:Danio rerio


Alignment Length:245 Identity:59/245 - (24%)
Similarity:93/245 - (37%) Gaps:57/245 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RSKVLSLVARAGSNRMMSTATK--LTTVE------VNDKTG-IATLTMNRPPV-NGLNLELLQDL 57
            |..:|||....|.....||:.|  .||..      |:::.| :..:.:|||.. |.:|.|..|.|
Zfish    15 RRAILSLNYVKGQRFNSSTSNKERKTTSSGSNGPVVSERRGAVMLIGINRPEARNAVNRETAQRL 79

  Fly    58 KSSIDEIESNKSRGLILTSSSSTIFSAGLDILEM-------------------YKPDKDRIRAFW 103
            ...:...:.:.|..:.:.......|.||.|:.|:                   ..|.:.|:    
Zfish    80 TEELSAFDQDDSLNVTVLYGVGGNFCAGFDLKELAHGSDSLELEQDVSSGPGPMGPSRMRL---- 140

  Fly   104 TQLQDTWLALYGSSVPTAAAINGHSPAGGCLLATSCEYRVMVPNFTIGLNETQLGIVAPQWFMAS 168
                         |.|..||::|::.|||..||...:.||...:..:|:...:.|:.    .:..
Zfish   141 -------------SKPLIAAVSGYAVAGGLELALLADMRVAEESSIMGVFCRRFGVP----LIDG 188

  Fly   169 FLSVLPQRIA-ERALN---QGRMFTTEEALKVGLIDETANN---KEEAIE 211
            ....|||.|. .|||:   .||.....|||..||.:....:   .:||:|
Zfish   189 GTVRLPQLIGLSRALDLILTGRPVKAHEALAFGLANRVVPDGQALQEALE 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 50/219 (23%)
zgc:101569NP_001005995.2 PRK08259 46..304 CDD:236205 49/214 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.