DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and auh

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001003576.2 Gene:auh / 445182 ZFINID:ZDB-GENE-040801-95 Length:325 Species:Danio rerio


Alignment Length:276 Identity:72/276 - (26%)
Similarity:118/276 - (42%) Gaps:38/276 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NRMMSTATKLTTVEVN------------DKTGIATLTMNRPPV-NGLNLELLQDLKSSIDEIES- 66
            :|..|...:|.:.|||            |.:||..:.:|||.. |.::..|:..:..:::.::: 
Zfish    43 HRAFSGGVRLYSSEVNSGDDLIVRYLDGDDSGIVVMGINRPEAKNAISKNLVSMMSEALESMKTD 107

  Fly    67 NKSRGLILTSSSSTIFSAGLDILEMYKPDKDRIRAFWTQLQDTWLALYGSSVPTAAAINGHSPAG 131
            |..|.:||.|....||.||.|:.|..|..:..:..|.|:.:.....|....:||.|||:|.:..|
Zfish   108 NTVRTVILCSMVPGIFCAGADLKERAKMQQSEVGPFVTKARTLISELGALPMPTIAAIDGAALGG 172

  Fly   132 GCLLATSCEYRVMVPNFTIGLNETQLGIVAPQWFMASFLSVLPQ----RIAERALNQGRMFTTEE 192
            |..:|.:|:.||...:..:||.||:|.|:..    |.....||:    .||:..:...|:...||
Zfish   173 GLEMALACDIRVAANSAKMGLVETKLAIIPG----AGGTQRLPRTVGVSIAKELIFAARVLNGEE 233

  Fly   193 ALKVGLIDETA-NNK--EEAIEKCVAFIGTFAKVNPLARSLTKQQFRAADLQQLQNG-------- 246
            |..:||::... .||  :.|..:.:.....|....|:|..:.|..........|:.|        
Zfish   234 AKSLGLVNHAVEQNKGGDAAYLRALDLAREFIPQGPIAVRMAKLAINQGIEVDLKTGLAIEEACY 298

  Fly   247 -----RKEDLEKFLFF 257
                 .|:.||..|.|
Zfish   299 SQVIPTKDRLEGLLAF 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 58/210 (28%)
auhNP_001003576.2 crotonase-like 71..325 CDD:304874 66/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.