DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and eci2

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001002645.3 Gene:eci2 / 436918 ZFINID:ZDB-GENE-040718-392 Length:392 Species:Danio rerio


Alignment Length:246 Identity:49/246 - (19%)
Similarity:103/246 - (41%) Gaps:35/246 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 TVEVNDKTGIATLTMNRP-PVNGLNLELLQDLKSSIDEIESNKSRGLILTSSSSTIFSAGLD--- 87
            |:.|:.:..|.|:.:||| ..|.:.:|:..:|..:: |:.......:.:.:.:...:.:|.|   
Zfish   139 TLLVSTEDNITTIRLNRPDKKNAITVEMYNELIEAL-ELAGKDDSVITVMTGNGDYYCSGNDLNN 202

  Fly    88 --------ILEMYKPDKDRIRAFWTQLQDTWLALYGSSVPTAAAINGHSPAGGCLLATSCEYRVM 144
                    :.:|.|...:.:|.:..       |......|....|||  ||.|..:.....:.|:
Zfish   203 FTKIPEGGVEKMAKDAGELLRRYVK-------AYIDFPKPLIGVING--PAVGVSVTLLGLFDVV 258

  Fly   145 --VPNFTIGLNETQLGIVAPQWFMASFLSVLPQRI----AERALNQGRMFTTEEALKVGLIDETA 203
              ....|.....:||| .:|:. .:|:|  .|:.:    |...|...:..:..:|.::||:.|..
Zfish   259 YATEKATFHTPFSQLG-QSPEG-CSSYL--FPKMMGAAKASEVLLFNKKLSATQACELGLVSEVF 319

  Fly   204 NNKEEAIEKCV-AFIGTFAKVNPLARSLTKQQFRAADLQQLQNGRKEDLEK 253
              .|.:.:..| :.:..:||:...:.:|:||..|..:.::|......::|:
Zfish   320 --PESSFQSEVWSRLKAYAKLPKNSLALSKQLIRGLEKEKLHAVNDAEVER 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 41/208 (20%)
eci2NP_001002645.3 ACBP 39..123 CDD:238248
crotonase-like 140..387 CDD:329030 48/245 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.