DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and CG5044

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_732020.2 Gene:CG5044 / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster


Alignment Length:321 Identity:63/321 - (19%)
Similarity:123/321 - (38%) Gaps:85/321 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSLVARAGSNRMMSTATKLTTVEVNDKTGIATLTMNRP-PVNGLNLELLQDLKSSIDEIESNKSR 70
            ::|..|..|:.:::|       |.::|   ..:.:||| .:|.:|||:::.:...:.:.|.:||.
  Fly    36 MALSVRQSSSSVLAT-------ESSNK---GMIILNRPKALNAINLEMVRKIYKHLKKCEKSKSL 90

  Fly    71 GLILTSSSSTIFSAGLDILEMYKP-DKDRIRAFWTQLQDTWLALYGSSVPTAAAINGHSPAGGCL 134
             :|:..:....|.||.|:..:.:. ..|..::|:.:...|...:....:|..|.|:|.:..||..
  Fly    91 -VIIKGTGDKAFCAGGDVRALVEAGPTDESKSFFREEYSTNALIGNYKIPYIAIIDGITMGGGVG 154

  Fly   135 LATSCEYRVMVPNFTIGLNETQLGI---VAPQWF-------MASFLSVLPQR----------IAE 179
            |:...:|||........:.||.:|:   |...:|       :..:|.:...|          ||.
  Fly   155 LSVHGKYRVASDRTLFAMPETAIGLFPDVGGSYFLPRLQGKLGLYLGLTGYRLRGADVYYSGIAT 219

  Fly   180 RALNQGRMFTTEEAL-----------------------------------------KVGLIDETA 203
            ......::...|.||                                         ..|:::...
  Fly   220 HYCESSKIPDLETALLNCPDADDVPELLQKYHSPPEKPFSLQPVLEQINKNFSADSVEGILENLQ 284

  Fly   204 NNKEEAIEKCVAFIGTFAKVNPLARSLTKQQFRAADLQQLQNGRKEDLEKFLFFVNQPAVQ 264
            |:..|..:|.   :.|.:|::|.:..:|   ||     ||:.|.:..|.:.|....:.||:
  Fly   285 NDGSEWAKKT---LETLSKMSPTSMKVT---FR-----QLELGSQLSLAQCLIMEYRLAVR 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 46/252 (18%)
CG5044NP_732020.2 PRK05617 44..376 CDD:235533 61/313 (19%)
ECH_2 56..374 CDD:292731 57/291 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451154
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.