DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and HIPP1

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_649261.1 Gene:HIPP1 / 40302 FlyBaseID:FBgn0037027 Length:926 Species:Drosophila melanogaster


Alignment Length:197 Identity:39/197 - (19%)
Similarity:72/197 - (36%) Gaps:17/197 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ELLQDLKSSIDEIESNKSRGLILTSSSSTIFSAGLDILEMYKPDKDRIRAFWTQLQDTWLALYGS 116
            :||:.|..::..:........:|.:.....|..|:|..|:.:...::.:...:||. ..|..|..
  Fly   698 QLLEQLNDTLSSVARKGEFNTVLLTVEGPQFCQGIDCQELIQGSLEKRKDSASQLA-VALKCYLR 761

  Fly   117 SV-----PTAAAINGHSPAGGCLLATSCEYRVMVPNFTIGLNETQLGIVAPQWFMASFLSVLPQR 176
            ::     |..|.|.|.....|.:.....:|.|...:.:...|..:||.:...:.:......:...
  Fly   762 TLATFPKPLVAGIVGSQINLGVMQLPFADYVVASDDCSFETNYAKLGQLPEGYALWHGHQRVSSE 826

  Fly   177 IAERALNQG-RMFTTEEALKVGLID---ETANNKEEAIEKC-------VAFIGTFAKVNPLARSL 230
            :..|....| |:|.||.......:|   :..|..|.|:.|.       .....|..|:|..|.::
  Fly   827 VHSRLFLMGERLFATELLESNSFVDKICKARNVNEMALAKAKQISTSSAEMYRTLKKLNHSAVNV 891

  Fly   231 TK 232
            ||
  Fly   892 TK 893

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 33/180 (18%)
HIPP1NP_649261.1 crotonase-like 673..870 CDD:119339 33/172 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451139
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.