DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and Echs1

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster


Alignment Length:288 Identity:74/288 - (25%)
Similarity:120/288 - (41%) Gaps:42/288 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RMMSTATKLTTVEVND-----KTGIA-------TLTMNRP-PVNGLNLELLQDLKSSIDEIESNK 68
            |....||:.::...|:     ||.:|       .:|:||| .:|.|...|:::|.:::.:...:|
  Fly    21 RQPQVATRFSSSSTNNNWEYIKTEVAGEGKNVGVITLNRPKALNALCNGLMKELSTALQQFSKDK 85

  Fly    69 SRGLILTSSSSTIFSAGLDILEMYKPDKDRIRAFWTQ------LQDTWLALYGSSVPTAAAINGH 127
            :...|:.:.|...|:||.||.||       :...::|      |.| |..:..:..|..||:||:
  Fly    86 TISAIVLTGSEKAFAAGADIKEM-------VGNTYSQCIQGNFLND-WTEVARTQKPIIAAVNGY 142

  Fly   128 SPAGGCLLATSCEYRVMVPNFTIGLNETQLGIVAPQWFMASFLSVLPQRIAERALNQGRMFTTEE 192
            :..|||.||..|:..........|..|..||.:...........|:.:..|......|.|...:|
  Fly   143 ALGGGCELAMMCDIIYAGDKAKFGQPEIALGTIPGAGGTQRLTRVVGKSKAMEMCLTGNMIGAQE 207

  Fly   193 ALKVGLIDETANNKE---EAI---EKCVAFIGTFAKVNPLARSLTKQQFRAADLQQLQNGRKEDL 251
            |.|:||..:.....:   ||:   ||    |||.:.   |...|.|:....|....||.|.|.:.
  Fly   208 AEKLGLASKVVPADQLLGEAVKLGEK----IGTHSN---LIVQLCKEAVNTAYETTLQEGLKFER 265

  Fly   252 EKFLFFVNQPAVQKGLGIYLEGLKKKAK 279
            ..|....:....::|:..:.|  |:.||
  Fly   266 RTFHATFSTADRKEGMTAFAE--KRPAK 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 54/214 (25%)
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 70/272 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451145
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.