DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and Auh

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_006253736.1 Gene:Auh / 361215 RGDID:1306087 Length:315 Species:Rattus norvegicus


Alignment Length:275 Identity:73/275 - (26%)
Similarity:116/275 - (42%) Gaps:20/275 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RAGSNRMMSTATKLTTVEVNDKT-GIATLTMNRP-PVNGLNLELLQDLKSSIDEIESNKS-RGLI 73
            |.|.:..:.|..:|....:.::. ||..|.:||. ..|.|:..||:.|..::|.::|:|. |.:|
  Rat    40 RRGYSSEVKTEDELRVRHLEEENRGIVVLGINRAYGKNSLSKNLLKMLSKAVDALKSDKKVRTII 104

  Fly    74 LTSSSSTIFSAGLDILEMYKPDKDRIRAFWTQLQDTWLALYGSSVPTAAAINGHSPAGGCLLATS 138
            :.|....||.||.|:.|..|.....:..|.::::.....:....|||.|||:|.:..||..||.:
  Rat   105 IRSEVPGIFCAGADLKERAKMHSSEVGPFVSKIRAVINDIANLPVPTIAAIDGLALGGGLELALA 169

  Fly   139 CEYRVMVPNFTIGLNETQLGIVAPQWFMASFLSVLPQRIAERALNQGRMFTTEEALKVGLIDETA 203
            |:.||...:..:||.||:|.|:............:...:|:..:...|:...:||..||||....
  Rat   170 CDIRVAASSAKMGLVETKLAIIPGGGGTQRLPRAIGMALAKELIFSARVLDGQEAKAVGLISHVL 234

  Fly   204 NNKEE---AIEKCVAFIGTFAKVNPLARSLTKQQFRAADLQQLQNG-------------RKEDLE 252
            ...:|   |..|.:.....|....|:|..:.|..........|..|             .|:.||
  Rat   235 EQNQEGDAAYRKALDLAREFLPQGPVAMRVAKLAINQGMEVDLVTGLAIEEACYAQTISTKDRLE 299

  Fly   253 KFLFF-VNQPAVQKG 266
            ..|.| ..:|...||
  Rat   300 GLLAFKEKRPPRYKG 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 55/195 (28%)
AuhXP_006253736.1 crotonase-like 62..315 CDD:329030 69/253 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.