DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and CG4592

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001260306.1 Gene:CG4592 / 34317 FlyBaseID:FBgn0032162 Length:287 Species:Drosophila melanogaster


Alignment Length:286 Identity:158/286 - (55%)
Similarity:210/286 - (73%) Gaps:9/286 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMRSKVLSLVAR-----AGSNRMMSTA----TKLTTVEVNDKTGIATLTMNRPPVNGLNLELLQD 56
            |:|::::..|.|     .|...:.|.|    :||||:||:|::|||||:||.||||.|.:||:.|
  Fly     1 MLRNRLIDGVRRIKPILCGGQSLRSLANGATSKLTTIEVDDRSGIATLSMNLPPVNTLTMELMHD 65

  Fly    57 LKSSIDEIESNKSRGLILTSSSSTIFSAGLDILEMYKPDKDRIRAFWTQLQDTWLALYGSSVPTA 121
            |..||::||||||||||||||:..:||||||:.||..||.:|:|.|||:.||.||||:...:|||
  Fly    66 LIDSINQIESNKSRGLILTSSNDKVFSAGLDLNEMLNPDVERLRLFWTRFQDLWLALHLCGLPTA 130

  Fly   122 AAINGHSPAGGCLLATSCEYRVMVPNFTIGLNETQLGIVAPQWFMASFLSVLPQRIAERALNQGR 186
            |||||||||.||:|||:||||||:||..||::.|:...|..:|.|.|:.||||:||.|||||||:
  Fly   131 AAINGHSPAAGCVLATACEYRVMLPNLFIGIHATRFSFVISKWMMNSYQSVLPRRIVERALNQGK 195

  Fly   187 MFTTEEALKVGLIDETANNKEEAIEKCVAFIGTFAKVNPLARSLTKQQFRAADLQQLQNGRKEDL 251
            :|.::|||.|||:||.|.:||||:.||.|||.||.|.||:||.|||:..|..|:::|...|..||
  Fly   196 LFASQEALDVGLVDEIACSKEEALSKCAAFIATFDKTNPVARCLTKRMCREPDVRELLQDRAADL 260

  Fly   252 EKFLFFVNQPAVQKGLGIYLEGLKKK 277
            ::.:.:|..|..|:||..:||||||:
  Fly   261 KECVDYVTTPLFQEGLCAHLEGLKKR 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 119/189 (63%)
CG4592NP_001260306.1 crotonase-like 43..284 CDD:304874 141/240 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435344
Domainoid 1 1.000 201 1.000 Domainoid score I2959
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 212 1.000 Inparanoid score I3624
Isobase 1 0.950 - 0 Normalized mean entropy S5440
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D435923at33208
OrthoFinder 1 1.000 - - FOG0006117
OrthoInspector 1 1.000 - - otm24924
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11941
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4409
1110.850

Return to query results.
Submit another query.