DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and echdc2

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_997953.1 Gene:echdc2 / 338247 ZFINID:ZDB-GENE-030219-147 Length:301 Species:Danio rerio


Alignment Length:261 Identity:61/261 - (23%)
Similarity:107/261 - (40%) Gaps:38/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KLTTVEVNDKTGIATLTMNRPPV-NGLN---LELLQDLKSSIDEIESNKSRGLILTSSSSTIFSA 84
            :|..:| .|..||..:.|.|... |.|.   :..::||.||:.  ..:..|.|:..|....:|.|
Zfish    40 RLNRLE-GDDNGIVEVLMCRERARNSLGHVFVGQMRDLVSSLQ--HDSAVRVLVFRSLIPGVFCA 101

  Fly    85 GLDILEMYKPDKDRIRAFWTQLQDTWLALYGSSVPTAAAINGHSPAGGCLLATSCEYRVMVPNFT 149
            |.|:.|..:........|...|:.....:....:||.||::|.:..||..||.:|:.|.......
Zfish   102 GADLKERAQMSNAEAELFVHGLRSLMNDIAALPMPTIAAVDGFALGGGLELALACDLRTAAHCAQ 166

  Fly   150 IGLNETQLGIVAPQWFMASFLSVLPQ----RIAERALNQGRMFTTEEALKVGLIDETA--NNKEE 208
            :||.||..|::..    |.....||:    .:|:..:..||....|:|:.:||::.:.  |...:
Zfish   167 MGLIETTRGLLPG----AGGSQRLPRTVGFAVAKELIFTGRRVGGEQAVNLGLVNRSVPQNQTGD 227

  Fly   209 AIEKCVAFIGTFAKVNPLARSLTKQQFRAADLQQLQNGRKEDLEKFLFFVNQPAVQKGLGIYLEG 273
            |..:         :...|||.:..|...|..:.::...|..:::          :..|:.|  ||
Zfish   228 AAHR---------EALSLAREILPQAPIAVRMAKVAMNRGAEVD----------ISSGMAI--EG 271

  Fly   274 L 274
            :
Zfish   272 M 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 50/199 (25%)
echdc2NP_997953.1 crotonase-like 47..301 CDD:304874 59/253 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.