DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and Hibch

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_006244957.1 Gene:Hibch / 301384 RGDID:1308392 Length:385 Species:Rattus norvegicus


Alignment Length:275 Identity:59/275 - (21%)
Similarity:107/275 - (38%) Gaps:51/275 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 MSTATKLTTVEVNDKTGIATLTMNRPP-VNGLNLELLQDLKSSIDEIESNKSRGL-ILTSSSSTI 81
            ||..|:...|.:..:.....:|:|||. :|.|:|.:::.:...:.:.|.:....| |:..:....
  Rat    28 MSKHTETAEVLLERRGCAGVITLNRPKLLNALSLNMIRQIYPQLKKWERDPDTFLIIIKGAGGKA 92

  Fly    82 FSAGLDILEMYKPDKDRIRAFWTQLQDTWL-------ALYGSSVPTAAAINGHSPAGGCLLATSC 139
            |.||.||..:.:..|    |..|..||.:.       |:.....|..|.|:|.:..||..|:...
  Rat    93 FCAGGDIKALSEAKK----AGQTLSQDLFREEYILNNAIASCQKPYVALIDGITMGGGVGLSVHG 153

  Fly   140 EYRVMVPNFTIGLNETQLGI---VAPQWF-------MASFLSVLPQR----------IAERALNQ 184
            ::||........:.||.:|:   |...:|       :..||::...|          ||...::.
  Rat   154 QFRVATERSLFAMPETGIGLFPDVGGGYFLPRLQGKLGYFLALTGFRLKGRDVHRAGIATHFVDS 218

  Fly   185 GRMFTTEE---ALK-------VGLIDETANNKEEAIEKCVAFIGTFAKVNPLARSLTKQQFRAAD 239
            .::...||   |||       .|:::......:...:|.:.|.....|:|..        |.|..
  Rat   219 EKLHVLEEELLALKSPSAEDVAGVLESYHAKSKMGQDKSIIFEEHMDKINSC--------FSANT 275

  Fly   240 LQQLQNGRKEDLEKF 254
            ::|:....::|...|
  Rat   276 VEQILENLRQDGSPF 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 48/228 (21%)
HibchXP_006244957.1 PRK05617 33..377 CDD:235533 56/270 (21%)
ECH_2 46..374 CDD:292731 55/257 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.