DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and Echdc2

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001100145.1 Gene:Echdc2 / 298381 RGDID:1308525 Length:296 Species:Rattus norvegicus


Alignment Length:275 Identity:63/275 - (22%)
Similarity:113/275 - (41%) Gaps:28/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ATKLTTVEVNDKT----GIATLTMNRPPV-NGLNLELLQDLKSSIDEI-ESNKSRGLILTSSSST 80
            :|:...::|...|    ||..:.||||.. |.|....:.:|..::.:: |..:.|.|:..|:...
  Rat    28 STRTPEIQVQALTGPNQGITEILMNRPHARNALGNVFVSELLEALAQLREDQQVRVLLFRSAVKG 92

  Fly    81 IFSAGLDILEMYKPDKDRIRAFWTQLQDTWLALYGSSVPTAAAINGHSPAGGCLLATSCEYRVMV 145
            :|.||.|:.|..:.....:..|..:|:.....:.....||.||::|.:..||..||.:|:.|:..
  Rat    93 VFCAGADLKERERMSAAEVGTFVQRLRGLMSEIAAFPAPTIAAMDGFALGGGLELALACDLRIAA 157

  Fly   146 PNFTIGLNETQLGIVAPQWFMASFLSVLPQRIAERALNQGRMFTTEEALKVGLIDETANNKEE-- 208
            .:..:||.||..|::............|...:|:..:..||.....:|.::||::......||  
  Rat   158 SSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELIFTGRRLNGVQAHELGLVNHAVAQNEEGD 222

  Fly   209 -AIEKCVAFIGTFAKVNPLARSLTKQQFRAADLQQLQNGRKED------LEKFLFFVNQPAVQKG 266
             |..:.:|.........|:|..|.|        ..:..|.:.|      :|...:..|.|...: 
  Rat   223 AAYHRALALAQEILPQAPIAVRLGK--------VAIDRGMEVDIASGMAIEHMCYAQNIPTQDR- 278

  Fly   267 LGIYLEGLKKKAKKQ 281
                |||:....:|:
  Rat   279 ----LEGMAAFREKR 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 49/198 (25%)
Echdc2NP_001100145.1 crotonase-like 42..296 CDD:304874 60/261 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.